(data stored in ACNUC7421 zone)

EMBL: CP002299.PE553

CP002299.PE553       Location/Qualifiers
FT   CDS             704872..705552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0562"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: kra:Krad_4111 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78641"
FT                   /db_xref="GOA:E3JBB1"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB1"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADP78641.1"
FT                   /translation="MALKTGTLISFVAMAAAATGGGLAGCPGPSGGSGSNPANPAGCAD
FT                   VEVVFARGSGELPGLGITGTPFVSSLTSDLAGKSVTSYAVNYAADLAQTSAGAGATDMS
FT                   NHVVSVAAKCPNTEFVLGGYSQGASVTDIAIGIPTLLGSGTTIPASLAPRVAAVVVFGN
FT                   PLALYGQHIPTASSLYGSKAQEFCAAGDPVCANGANGVAHLSYPTNGMTTQGAAFAAAK
FT                   VKSS"
     MALKTGTLIS FVAMAAAATG GGLAGCPGPS GGSGSNPANP AGCADVEVVF ARGSGELPGL        60
     GITGTPFVSS LTSDLAGKSV TSYAVNYAAD LAQTSAGAGA TDMSNHVVSV AAKCPNTEFV       120
     LGGYSQGASV TDIAIGIPTL LGSGTTIPAS LAPRVAAVVV FGNPLALYGQ HIPTASSLYG       180
     SKAQEFCAAG DPVCANGANG VAHLSYPTNG MTTQGAAFAA AKVKSS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page