(data stored in ACNUC7421 zone)

EMBL: CP002299.PE554

CP002299.PE554       Location/Qualifiers
FT   CDS             705637..706077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: art:Arth_3902 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78642"
FT                   /db_xref="GOA:E3JBB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADP78642.1"
FT                   /translation="MTPEDLANLAHLRRARDLMDREYASPLDVAALARAALMSTAHFSR
FT                   QFRAAYGETPYSYLMTRRIERAKALLRRGDLSVTDVCMAVGCTSLGSFSARFTELVGET
FT                   PTAYRARDHGALAGVPGCVAKDLTRPSRRPSRIGEARGPAVP"
     MTPEDLANLA HLRRARDLMD REYASPLDVA ALARAALMST AHFSRQFRAA YGETPYSYLM        60
     TRRIERAKAL LRRGDLSVTD VCMAVGCTSL GSFSARFTEL VGETPTAYRA RDHGALAGVP       120
     GCVAKDLTRP SRRPSRIGEA RGPAVP                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page