(data stored in ACNUC7421 zone)

EMBL: CP002299.PE557

CP002299.PE557       Location/Qualifiers
FT   CDS             709567..710763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0567"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: scb:SCAB_77071 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78645"
FT                   /db_xref="GOA:E3J3M4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3M4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADP78645.1"
FT                   /translation="MERVWAGVDIGKEHHHVVVIDADGARMLSRRVANDEPTLLDLLGQ
FT                   VTALAERVHWAVDLSTGGAALLLGLLVAHGQQVFYLSGNQVSRAAGGYRGEGKTDAKDA
FT                   AIIADQVRMRRDLAPMRVDDELIVELRMLVARRRDLAGDRVRLVNRLHEHLLGISPALE
FT                   RVLNLTNRGPLVLLTHVQTPAAIRQLGPAGLEQWLRSQKVRGAAALAATVTAAANSQRT
FT                   TLPGEQLAAQLVADMAKGVMSLDEQIAQTDTLIEGRFHRHRHAAALLSMPGIGVLLGAE
FT                   FLAATGGDMAAFTSADHLAGYAGLAPAPRDSGRISGNLHRPRRYHRGLQRVFYTSALVS
FT                   IRYNDQSRTFYDRKRSEGKRHTQAVLALARRRVNVIWALLRDNRCYQPAPPPLIAAAA"
     MERVWAGVDI GKEHHHVVVI DADGARMLSR RVANDEPTLL DLLGQVTALA ERVHWAVDLS        60
     TGGAALLLGL LVAHGQQVFY LSGNQVSRAA GGYRGEGKTD AKDAAIIADQ VRMRRDLAPM       120
     RVDDELIVEL RMLVARRRDL AGDRVRLVNR LHEHLLGISP ALERVLNLTN RGPLVLLTHV       180
     QTPAAIRQLG PAGLEQWLRS QKVRGAAALA ATVTAAANSQ RTTLPGEQLA AQLVADMAKG       240
     VMSLDEQIAQ TDTLIEGRFH RHRHAAALLS MPGIGVLLGA EFLAATGGDM AAFTSADHLA       300
     GYAGLAPAPR DSGRISGNLH RPRRYHRGLQ RVFYTSALVS IRYNDQSRTF YDRKRSEGKR       360
     HTQAVLALAR RRVNVIWALL RDNRCYQPAP PPLIAAAA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page