(data stored in ACNUC7421 zone)

EMBL: CP002299.PE56

CP002299.PE56        Location/Qualifiers
FT   CDS             complement(62364..63506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0056"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="TIGRFAM: glycerate kinase; KEGG: fal:FRAAL6785
FT                   glycerate kinase I; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78144"
FT                   /db_xref="GOA:E3J3E2"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E2"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ADP78144.1"
FT                   /translation="MADRLKVVIAPDSFKGSLAADRVAAALAEGWLSVRPTDEVVRLPI
FT                   ADGGEGTLDVFAAAVPGARRRPATVTGPRGQLVDAEWLALPDGTAVVELARGSGLPLMG
FT                   DRRDARAAHTVGLGQLLAAALDDPGIRQIIVTLGGSASTDGGTGALAALGARFLDATGA
FT                   ALPPGGGSLVRLAGVDLGGLRKPPPDGVLCLTDVDAPLCGPRGAAAVFGPQKGATEADV
FT                   PALDEGLRRLAALLGGAPDAPGAGAAGGTGYGLAAAWGARLVPGAATVAEHAGLPDALA
FT                   EADLVITGEGRFDATSLTGKVVGGVLGLAAARPGASGPVPVLLVAGQLGAPAPSGVRTA
FT                   LALATLAGGVAPAVAEPEHWLTRAATRLATATTNQLGDRP"
     MADRLKVVIA PDSFKGSLAA DRVAAALAEG WLSVRPTDEV VRLPIADGGE GTLDVFAAAV        60
     PGARRRPATV TGPRGQLVDA EWLALPDGTA VVELARGSGL PLMGDRRDAR AAHTVGLGQL       120
     LAAALDDPGI RQIIVTLGGS ASTDGGTGAL AALGARFLDA TGAALPPGGG SLVRLAGVDL       180
     GGLRKPPPDG VLCLTDVDAP LCGPRGAAAV FGPQKGATEA DVPALDEGLR RLAALLGGAP       240
     DAPGAGAAGG TGYGLAAAWG ARLVPGAATV AEHAGLPDAL AEADLVITGE GRFDATSLTG       300
     KVVGGVLGLA AARPGASGPV PVLLVAGQLG APAPSGVRTA LALATLAGGV APAVAEPEHW       360
     LTRAATRLAT ATTNQLGDRP                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page