(data stored in ACNUC7421 zone)

EMBL: CP002299.PE561

CP002299.PE561       Location/Qualifiers
FT   CDS             715143..715961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0571"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3081 short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78649"
FT                   /db_xref="GOA:E3JBB9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP78649.1"
FT                   /translation="MGKLDGKVAFITGAARGQGRSHAVRLAEEGADIIGIDICAQMESV
FT                   QYPMGTQAELDQTVKEVEALGRRIVALKADVRDVAGLQAAFDEGVAALGPVDIVVANAG
FT                   IGAGGKAIAPETEWDEVVAVNMTGVWNTGRVAIPSMLQRGKGGSIILTSSTGGLVGVGI
FT                   PTSGFLAYTAAKHGVIGLMRSWANFLAPHMIRVNSVAPTAVRTPMAGDGDLKAIMERNP
FT                   ALANALTNAMPVDLVEPLDVSNAVLWLASDEARYITGTVVPVDAGLINKR"
     MGKLDGKVAF ITGAARGQGR SHAVRLAEEG ADIIGIDICA QMESVQYPMG TQAELDQTVK        60
     EVEALGRRIV ALKADVRDVA GLQAAFDEGV AALGPVDIVV ANAGIGAGGK AIAPETEWDE       120
     VVAVNMTGVW NTGRVAIPSM LQRGKGGSII LTSSTGGLVG VGIPTSGFLA YTAAKHGVIG       180
     LMRSWANFLA PHMIRVNSVA PTAVRTPMAG DGDLKAIMER NPALANALTN AMPVDLVEPL       240
     DVSNAVLWLA SDEARYITGT VVPVDAGLIN KR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page