(data stored in ACNUC7421 zone)

EMBL: CP002299.PE565

CP002299.PE565       Location/Qualifiers
FT   CDS             718195..719292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0575"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: sen:SACE_3888 CorA-like putative magnesium transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78653"
FT                   /db_xref="GOA:E3JBC3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC3"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADP78653.1"
FT                   /translation="MGDATAGNPGRPGGTVGWNGSSNLACRVDPDADPTNRVGREPPRT
FT                   RVYRAGKLEAEGFPVARVSDYLEEPDTVVWLDLCAPRPDELHVISEELNLSSLAVEDAV
FT                   SPRERPKLDRYDSHLFLNAYSVSFDRDSGEVATHEVAAFITQKALVTVRQDEGFDVDGL
FT                   LAHWGEVGQELGQYGVSYLVHGLLDFIVDQHFAAVQSLDTEIETLEDLLFDDAPHDGAV
FT                   QRRSYELRKSLVLLRRVVLPMREVVNTIMRRDLHLVSPEIAPYYQDVYDHVLRATEWTE
FT                   SLRDLVTTILETNLTIQGNRMNLIMKRLSAWAAVIAVPTAITGFYGQNVPYPGFGKEWG
FT                   FAVSVGVLLGCAGFLYVAFKRRDWL"
     MGDATAGNPG RPGGTVGWNG SSNLACRVDP DADPTNRVGR EPPRTRVYRA GKLEAEGFPV        60
     ARVSDYLEEP DTVVWLDLCA PRPDELHVIS EELNLSSLAV EDAVSPRERP KLDRYDSHLF       120
     LNAYSVSFDR DSGEVATHEV AAFITQKALV TVRQDEGFDV DGLLAHWGEV GQELGQYGVS       180
     YLVHGLLDFI VDQHFAAVQS LDTEIETLED LLFDDAPHDG AVQRRSYELR KSLVLLRRVV       240
     LPMREVVNTI MRRDLHLVSP EIAPYYQDVY DHVLRATEWT ESLRDLVTTI LETNLTIQGN       300
     RMNLIMKRLS AWAAVIAVPT AITGFYGQNV PYPGFGKEWG FAVSVGVLLG CAGFLYVAFK       360
     RRDWL                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page