(data stored in ACNUC7421 zone)

EMBL: CP002299.PE566

CP002299.PE566       Location/Qualifiers
FT   CDS             719441..720592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0576"
FT                   /product="Peptidase M75, Imelysin"
FT                   /note="PFAM: Peptidase M75, Imelysin; KEGG: cai:Caci_7481
FT                   iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78654"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC4"
FT                   /inference="protein motif:PFAM:PF09375"
FT                   /protein_id="ADP78654.1"
FT                   /translation="MVIAAVGVTLGLTLGRGGSGASAEQPVRSPRISIGLSGCGTGWTK
FT                   PAAGQQDFLLVNTDLRNGDAQLIDPASGAVYAEVEPLGSGASAHLRIMLGHGSYAFRCV
FT                   MEDDTAITGPTVTIGGTLRTPVAPVLPVTRNDLVPVARAYETYVNNALPGLIGLTRTLS
FT                   ADIGRGDLAAARRDWLPAHLAYERLGAAYGAFDTADSAINGRPDGLPDGLQDSGFTGFH
FT                   RLEYGLWHGESAASLGPAADALVTAETDLQSAFPQAQIDPLDIAIRAHEITENTLQFTL
FT                   TGHDDLGSGSELATARANLDGTRTVLGLLRPLLTSRYPALPALDPLIATTDRDLAAFQH
FT                   PDGTYPALADLSVPDRERVDSDFSELSEQLAPIASICEPRRTQ"
     MVIAAVGVTL GLTLGRGGSG ASAEQPVRSP RISIGLSGCG TGWTKPAAGQ QDFLLVNTDL        60
     RNGDAQLIDP ASGAVYAEVE PLGSGASAHL RIMLGHGSYA FRCVMEDDTA ITGPTVTIGG       120
     TLRTPVAPVL PVTRNDLVPV ARAYETYVNN ALPGLIGLTR TLSADIGRGD LAAARRDWLP       180
     AHLAYERLGA AYGAFDTADS AINGRPDGLP DGLQDSGFTG FHRLEYGLWH GESAASLGPA       240
     ADALVTAETD LQSAFPQAQI DPLDIAIRAH EITENTLQFT LTGHDDLGSG SELATARANL       300
     DGTRTVLGLL RPLLTSRYPA LPALDPLIAT TDRDLAAFQH PDGTYPALAD LSVPDRERVD       360
     SDFSELSEQL APIASICEPR RTQ                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page