(data stored in ACNUC7421 zone)

EMBL: CP002299.PE567

CP002299.PE567       Location/Qualifiers
FT   CDS             720589..721911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0577"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="KEGG: cai:Caci_1778 Dyp-type peroxidase family;
FT                   TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78655"
FT                   /db_xref="GOA:E3JBC5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC5"
FT                   /inference="protein motif:TFAM:TIGR01413"
FT                   /protein_id="ADP78655.1"
FT                   /translation="MSDLTGDGTAGVDGGGARGWGSPERGRRLDRRSLLRGSALAAAAA
FT                   TAGGGATAAAGTAVAQAPAAAVPTGATVRPARFVAFHGTHQAGILLPAQAYSVTAAFDV
FT                   TARSRGELTDLLRALTDRTRLLATGGVPPNDGISAPPADSGVLGPTLTGTGLTVTVGVG
FT                   ASLFDGRFGLGPARPRRLTTMPTFPNDSLDRAQCDGDLVVQICADAPDSPLHAIRDLTR
FT                   HTRGGMQARWRVDGFLSPPRPDGAPRNLMGFKDGTANPAVATPAVADRLLWAARDEPAW
FT                   ATGGSYLVVRLIRMLVEFWDRVTISEQERMIGRRRDSGAPLSGTVEADTPSYSDDATGG
FT                   KIPLDAHIRLANPRTPETAASVPLRRGYNYDRGLDSNGNLDMGLVFTAFQQDLERQFAA
FT                   VQGRLADEPLTDYIVPFGGGYFFALPGVRDGADWFGRALLA"
     MSDLTGDGTA GVDGGGARGW GSPERGRRLD RRSLLRGSAL AAAAATAGGG ATAAAGTAVA        60
     QAPAAAVPTG ATVRPARFVA FHGTHQAGIL LPAQAYSVTA AFDVTARSRG ELTDLLRALT       120
     DRTRLLATGG VPPNDGISAP PADSGVLGPT LTGTGLTVTV GVGASLFDGR FGLGPARPRR       180
     LTTMPTFPND SLDRAQCDGD LVVQICADAP DSPLHAIRDL TRHTRGGMQA RWRVDGFLSP       240
     PRPDGAPRNL MGFKDGTANP AVATPAVADR LLWAARDEPA WATGGSYLVV RLIRMLVEFW       300
     DRVTISEQER MIGRRRDSGA PLSGTVEADT PSYSDDATGG KIPLDAHIRL ANPRTPETAA       360
     SVPLRRGYNY DRGLDSNGNL DMGLVFTAFQ QDLERQFAAV QGRLADEPLT DYIVPFGGGY       420
     FFALPGVRDG ADWFGRALLA                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page