(data stored in ACNUC7421 zone)

EMBL: CP002299.PE57

CP002299.PE57        Location/Qualifiers
FT   CDS             complement(63573..64562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0057"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="TIGRFAM: adenosine deaminase; KEGG: fal:FRAAL6786
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78145"
FT                   /db_xref="GOA:E3J3E3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E3"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ADP78145.1"
FT                   /translation="MRDLRALPKGHLHLHFELGMRPSTLADLAARNGVPTPPTTGFTEF
FT                   GGFGVVIGGILPMFREVADFERLVDEVVEDAAQEGVVYLEPSFYPYPYLDVFGTAEAAW
FT                   ETVLARSALAAERHGVTVRWMAAVDRVFDTPAQAVEVAKLAVRNRDAGVVALGLHNDEN
FT                   GYPPEPFADAFRYAKDAGLLSTPHAGELDGPASVRGAIDVLLADRLQHGIRAVEDPALV
FT                   EVLAARGTVLDVCPTSNLQLSVVPSLAEHPLPELLAAGVRCSINADDPLLFGPSILREY
FT                   ELCRDAFGLDDELLATCARSSVTGGAAPAEVQATALAGIDAWLAAPAG"
     MRDLRALPKG HLHLHFELGM RPSTLADLAA RNGVPTPPTT GFTEFGGFGV VIGGILPMFR        60
     EVADFERLVD EVVEDAAQEG VVYLEPSFYP YPYLDVFGTA EAAWETVLAR SALAAERHGV       120
     TVRWMAAVDR VFDTPAQAVE VAKLAVRNRD AGVVALGLHN DENGYPPEPF ADAFRYAKDA       180
     GLLSTPHAGE LDGPASVRGA IDVLLADRLQ HGIRAVEDPA LVEVLAARGT VLDVCPTSNL       240
     QLSVVPSLAE HPLPELLAAG VRCSINADDP LLFGPSILRE YELCRDAFGL DDELLATCAR       300
     SSVTGGAAPA EVQATALAGI DAWLAAPAG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page