(data stored in ACNUC7421 zone)

EMBL: CP002299.PE575

CP002299.PE575       Location/Qualifiers
FT   CDS             734418..736232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0585"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: nca:Noca_3235 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78663"
FT                   /db_xref="GOA:E3JCG7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR022506"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3JCG7"
FT                   /inference="similar to AA sequence:KEGG:Noca_3235"
FT                   /protein_id="ADP78663.1"
FT                   /translation="MTTKPWAEPGPPASTGQAEPVTTAQRRLVRGEARAGGYRPLVAGP
FT                   GEPVLVRTDLLAEAPGATPAGERRTLLAFAHLSDLHVVDHQSPARAEFLERVGDPDSPF
FT                   WEKVQELGAYRPNEAFAAHVVEAMVQTVNAHAQATPLAFSIVTGDATDNCQANELSWYR
FT                   DVLDGGGDVQVDSGSPARYHGVADDDHYDVRFWHPDGTPPGRPDDQARAEYGFPEVPGV
FT                   IDAARRAFAATGLATPWYAVHGNHDNLVQGTAVPEEPIPTLAVGDAKIYDLAPGADLTT
FT                   VGRAVDTGDLEAFAVLLAGPTRTVPADERRRPVRRAEHIAAHFDTRGLPVGHGYTEANR
FT                   ADGTAYYTFTAAAGLNGLPPVVGVVLDTVNPYGGWQGALDEAQLTWLEGVLQRGSARWL
FT                   AEDGSIATGTGPDSLFILFSHHPLDCLVNDQAPDDAPRVLLSRVRDLLLRYPNVIGWVN
FT                   GHTHRHTVTPYARPAGSPVAGGFWEITTASHIDWPQQSRLIELVDNGDGTLAFVATVLD
FT                   TAAPAAADYDEFRGYAQTSAVLATGAEREAGPVDPLALAALSRELAANYWQRRPGNDAD
FT                   PDPGGGSGAGTVLDRNVDLRLPAPVPLP"
     MTTKPWAEPG PPASTGQAEP VTTAQRRLVR GEARAGGYRP LVAGPGEPVL VRTDLLAEAP        60
     GATPAGERRT LLAFAHLSDL HVVDHQSPAR AEFLERVGDP DSPFWEKVQE LGAYRPNEAF       120
     AAHVVEAMVQ TVNAHAQATP LAFSIVTGDA TDNCQANELS WYRDVLDGGG DVQVDSGSPA       180
     RYHGVADDDH YDVRFWHPDG TPPGRPDDQA RAEYGFPEVP GVIDAARRAF AATGLATPWY       240
     AVHGNHDNLV QGTAVPEEPI PTLAVGDAKI YDLAPGADLT TVGRAVDTGD LEAFAVLLAG       300
     PTRTVPADER RRPVRRAEHI AAHFDTRGLP VGHGYTEANR ADGTAYYTFT AAAGLNGLPP       360
     VVGVVLDTVN PYGGWQGALD EAQLTWLEGV LQRGSARWLA EDGSIATGTG PDSLFILFSH       420
     HPLDCLVNDQ APDDAPRVLL SRVRDLLLRY PNVIGWVNGH THRHTVTPYA RPAGSPVAGG       480
     FWEITTASHI DWPQQSRLIE LVDNGDGTLA FVATVLDTAA PAAADYDEFR GYAQTSAVLA       540
     TGAEREAGPV DPLALAALSR ELAANYWQRR PGNDADPDPG GGSGAGTVLD RNVDLRLPAP       600
     VPLP                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page