(data stored in ACNUC7421 zone)

EMBL: CP002299.PE61

CP002299.PE61        Location/Qualifiers
FT   CDS             complement(67053..68330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0061"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ape:APE_2269.1 putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78149"
FT                   /db_xref="GOA:E3J3E7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78149.1"
FT                   /translation="MTNQQATGGDGSASRWGALASYAAIAACTQLLWLTFAPITTDAAQ
FT                   HYGVSEGAIGWLANVFPLLYVVLGIPAGRLLDRSMRTWLAVGAVLTAAGGLVRLAGGGF
FT                   GVAIAGQLLVAVAQPLVLNAVTALAGGYLAHRHRAAGIALGSASLFVGMIAAFVLGAAV
FT                   GASRMTALLAVQAALTVVATVAVLFALRRPGPFAAAAGAGAVAGDGELVPGEAAARGAV
FT                   RRLWADEVVRRLVTIVTLGFGVFIALTTWLQALLKPAGVSTGVAGALLIGMVAAGTAGS
FT                   AVLPAWAARRGRRTEVIRLSVGVTVVGCAVLAVAPGVTTAAVAVCLMGLLLLADLPILL
FT                   EVAENRPGGDVATLAALVWLAGNAGGVVVSLAVQGLLHHPAAAFALLAVVLLAGVPVLR
FT                   TRWLDAPPGGDASPAAAAAAAVGEAV"
     MTNQQATGGD GSASRWGALA SYAAIAACTQ LLWLTFAPIT TDAAQHYGVS EGAIGWLANV        60
     FPLLYVVLGI PAGRLLDRSM RTWLAVGAVL TAAGGLVRLA GGGFGVAIAG QLLVAVAQPL       120
     VLNAVTALAG GYLAHRHRAA GIALGSASLF VGMIAAFVLG AAVGASRMTA LLAVQAALTV       180
     VATVAVLFAL RRPGPFAAAA GAGAVAGDGE LVPGEAAARG AVRRLWADEV VRRLVTIVTL       240
     GFGVFIALTT WLQALLKPAG VSTGVAGALL IGMVAAGTAG SAVLPAWAAR RGRRTEVIRL       300
     SVGVTVVGCA VLAVAPGVTT AAVAVCLMGL LLLADLPILL EVAENRPGGD VATLAALVWL       360
     AGNAGGVVVS LAVQGLLHHP AAAFALLAVV LLAGVPVLRT RWLDAPPGGD ASPAAAAAAA       420
     VGEAV                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page