(data stored in ACNUC7421 zone)

EMBL: CP002299.PE62

CP002299.PE62        Location/Qualifiers
FT   CDS             68446..69081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0062"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: kfl:Kfla_4998 two component transcriptional
FT                   regulator, LuxR family; PFAM: regulatory protein LuxR;
FT                   response regulator receiver; SMART: regulatory protein
FT                   LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78150"
FT                   /db_xref="GOA:E3J3E8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADP78150.1"
FT                   /translation="MLAEDLALLRDGLIRLLTAFDFEVVESVDNGPALLRALVTHRPDV
FT                   AVVDVRLPPTFTDEGLLAAIEARGQVPGLPVLVLSQDVQPVYARELLSSPGGGVGYLLK
FT                   DRVGDVGQFVDSVRRVAAGGSAMDPEVVAELLTRRSRDQPLQALTAREREVLGLMAEGR
FT                   SNAAIAGRLFITEKAVGKHTNNIFAKLSLPPSADDNRRVLAVLAYLNS"
     MLAEDLALLR DGLIRLLTAF DFEVVESVDN GPALLRALVT HRPDVAVVDV RLPPTFTDEG        60
     LLAAIEARGQ VPGLPVLVLS QDVQPVYARE LLSSPGGGVG YLLKDRVGDV GQFVDSVRRV       120
     AAGGSAMDPE VVAELLTRRS RDQPLQALTA REREVLGLMA EGRSNAAIAG RLFITEKAVG       180
     KHTNNIFAKL SLPPSADDNR RVLAVLAYLN S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page