(data stored in ACNUC7421 zone)

EMBL: CP002299.PE63

CP002299.PE63        Location/Qualifiers
FT   CDS             complement(69104..69805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0063"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ara:Arad_9385
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78151"
FT                   /db_xref="GOA:E3J3E9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78151.1"
FT                   /translation="MTGTKDLYTSGEYLGLNPGRHDGDGAWKALQIARILERNNLRPNS
FT                   VCDVGCGTGRVLRELSHHLPGTPRMVGFDIAAAPLGLNEDTGEGVELVTGDARASDEYF
FT                   DLLMMVDVFEHVEDYLGFLRSFRDRAGVFVFHIPLDMSVQTVLRAKPLLGARRGVGHLH
FT                   YFSRETALATLADAGYRVIDEAYTRGGVELAVSGRRRVARVPRQVAHRLNPDLAARVLG
FT                   GSSLLVLAEGA"
     MTGTKDLYTS GEYLGLNPGR HDGDGAWKAL QIARILERNN LRPNSVCDVG CGTGRVLREL        60
     SHHLPGTPRM VGFDIAAAPL GLNEDTGEGV ELVTGDARAS DEYFDLLMMV DVFEHVEDYL       120
     GFLRSFRDRA GVFVFHIPLD MSVQTVLRAK PLLGARRGVG HLHYFSRETA LATLADAGYR       180
     VIDEAYTRGG VELAVSGRRR VARVPRQVAH RLNPDLAARV LGGSSLLVLA EGA              233
//

If you have problems or comments...

PBIL Back to PBIL home page