(data stored in ACNUC7421 zone)

EMBL: CP002299.PE64

CP002299.PE64        Location/Qualifiers
FT   CDS             complement(70301..71116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0064"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78152"
FT                   /db_xref="GOA:E3J3F0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F0"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADP78152.1"
FT                   /translation="MAATRYPSATWRPVVNTSGTMIEPTRGLIPHVQQGNGSLYGMFNT
FT                   PSTQVSSHLWLSKGGGWEQYVDLADKAWAEAAGNPYWISVECEGFDTEDYSPIQVQRLA
FT                   EFYAWGMTEFGWKAEITDSVDGYGIGTHRMGGTAWGGHSCPGDIRANRRQDVLSAALAL
FT                   NGTPPPTPNPSQAQQRYVNMPTLRSGSKGSAVVTLQNALNIIFGHEAPTGDPNRLVPDG
FT                   SFGPATLARVGSLQRLNSPYYGPIGVDGVVGRQTWLKIGYILTGMNRSV"
     MAATRYPSAT WRPVVNTSGT MIEPTRGLIP HVQQGNGSLY GMFNTPSTQV SSHLWLSKGG        60
     GWEQYVDLAD KAWAEAAGNP YWISVECEGF DTEDYSPIQV QRLAEFYAWG MTEFGWKAEI       120
     TDSVDGYGIG THRMGGTAWG GHSCPGDIRA NRRQDVLSAA LALNGTPPPT PNPSQAQQRY       180
     VNMPTLRSGS KGSAVVTLQN ALNIIFGHEA PTGDPNRLVP DGSFGPATLA RVGSLQRLNS       240
     PYYGPIGVDG VVGRQTWLKI GYILTGMNRS V                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page