(data stored in ACNUC7421 zone)

EMBL: CP002299.PE66

CP002299.PE66        Location/Qualifiers
FT   CDS             72846..75383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78154"
FT                   /db_xref="GOA:E3J3F2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6779"
FT                   /protein_id="ADP78154.1"
FT                   /translation="MSTPPGPSESRDPTPGGRSGAFWTSAARLAGQRGGIVAVIALVLT
FT                   VGLGFGISQLKFSTDQSNYLNSNSQVAKDNHAYQSLFGGESMITDFTVDPGKNLTDLFT
FT                   PNNLKAFAAVTKELEADKRIVAVVTPVTALQFTHNLVSSPDGNPINSPAAKMLLSAQQR
FT                   DTDPTSQATRLQDAIKTLGRVNAIPPAQQTIGSPAWDNFLLYDNSGKVREALVPFFPNR
FT                   TNAQMVVRLEGNASIKDEGAAASLVQEAMAKQHFENAHVVTTGASVLLKDINDYLRGGF
FT                   LTLGAIALALMVGLLLVAFAVRWRLLPLGVVVVGLIWAFGLAGYLGIHLNVVTIAGLPV
FT                   LLGVGIDFAVQLHSRVEEEAQLDRADNPVAATLRNLMPALLLATVAAVVAFLALEFNAT
FT                   PMIRDFGVLLAIGLPVIVLATVLLTSATLAWREDKRPTQPKDYTRGPLGRATVTLGSLP
FT                   RVAALPLVVIAIAVFVGGAFVEGGQKIQTDPQKWVNQNSQVIKDLDYLGDHAGTTSELG
FT                   VYIQADNLFDDKTAAFVNTVARDQIAKHPDVLTNASSLVTTVGYLLDVPGAKMVPPTGD
FT                   DVRAAYAVAPAAIRSSTVNLSSPGGTAGAMNLIFQTGPSSLVQRAVVVKDIRATVQPPA
FT                   GVRATPSGLAVVGTSLLDNIGHNRALLTYYALIGVFLVLLLRYLSLAKALLSVVPVLIA
FT                   VGLTSLIARGSGLELSPLTAVSGPLVIALCTEFTTLIVQRHLEERALGLAPRAAVDEAA
FT                   ARTGRAFLVSAAAAVVGILVLAFSPLPLLRDFGLIVALNVAVALLSALVVLPPLLVWAD
FT                   ERGWVYRPQGGAGDAAAGRSASPADTPTGSSVA"
     MSTPPGPSES RDPTPGGRSG AFWTSAARLA GQRGGIVAVI ALVLTVGLGF GISQLKFSTD        60
     QSNYLNSNSQ VAKDNHAYQS LFGGESMITD FTVDPGKNLT DLFTPNNLKA FAAVTKELEA       120
     DKRIVAVVTP VTALQFTHNL VSSPDGNPIN SPAAKMLLSA QQRDTDPTSQ ATRLQDAIKT       180
     LGRVNAIPPA QQTIGSPAWD NFLLYDNSGK VREALVPFFP NRTNAQMVVR LEGNASIKDE       240
     GAAASLVQEA MAKQHFENAH VVTTGASVLL KDINDYLRGG FLTLGAIALA LMVGLLLVAF       300
     AVRWRLLPLG VVVVGLIWAF GLAGYLGIHL NVVTIAGLPV LLGVGIDFAV QLHSRVEEEA       360
     QLDRADNPVA ATLRNLMPAL LLATVAAVVA FLALEFNATP MIRDFGVLLA IGLPVIVLAT       420
     VLLTSATLAW REDKRPTQPK DYTRGPLGRA TVTLGSLPRV AALPLVVIAI AVFVGGAFVE       480
     GGQKIQTDPQ KWVNQNSQVI KDLDYLGDHA GTTSELGVYI QADNLFDDKT AAFVNTVARD       540
     QIAKHPDVLT NASSLVTTVG YLLDVPGAKM VPPTGDDVRA AYAVAPAAIR SSTVNLSSPG       600
     GTAGAMNLIF QTGPSSLVQR AVVVKDIRAT VQPPAGVRAT PSGLAVVGTS LLDNIGHNRA       660
     LLTYYALIGV FLVLLLRYLS LAKALLSVVP VLIAVGLTSL IARGSGLELS PLTAVSGPLV       720
     IALCTEFTTL IVQRHLEERA LGLAPRAAVD EAAARTGRAF LVSAAAAVVG ILVLAFSPLP       780
     LLRDFGLIVA LNVAVALLSA LVVLPPLLVW ADERGWVYRP QGGAGDAAAG RSASPADTPT       840
     GSSVA                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page