(data stored in ACNUC7421 zone)

EMBL: CP002299.PE68

CP002299.PE68        Location/Qualifiers
FT   CDS             complement(77564..77761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0068"
FT                   /product="Domain of unknown function DUF1918"
FT                   /note="PFAM: Domain of unknown function DUF1918; KEGG:
FT                   fal:FRAAL6778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78156"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F4"
FT                   /inference="protein motif:PFAM:PF08940"
FT                   /protein_id="ADP78156.1"
FT                   /translation="MHATAGDRVCVRSRTVGQAERHGVVLEVRGKPDGPPYLIRWDDGH
FT                   EGLCFPSADSVLEIFAKQHT"
     MHATAGDRVC VRSRTVGQAE RHGVVLEVRG KPDGPPYLIR WDDGHEGLCF PSADSVLEIF        60
     AKQHT                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page