(data stored in ACNUC7421 zone)

EMBL: CP002299.PE72

CP002299.PE72        Location/Qualifiers
FT   CDS             83211..84899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78160"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6769"
FT                   /protein_id="ADP78160.1"
FT                   /translation="METGQTVRTDETMRQLSLPGVLVLVSTPSADHLVADNVGWHRTVA
FT                   QAGLPRATKLVALVLSSHVQPADGTDPDLPAGAAFCAPGLPVLVEQTGYSRTHVQRQLA
FT                   KLRELGWLSTVGRPAAGRPARFVLTLPAEVARLAGVGLAVPSQAPVAGQAPAPGPVPAS
FT                   HRPARPEPLAATARVAMQGWRPLDDVPARAGFAMPERNAPTRAPDEVVASAVAGRPKSR
FT                   RAAGHRVEGATETAVVEWEEDEEQVTEEDGPLTATGDRPRVIVGRHVFRRRGGRPLDNS
FT                   KAAVRRRAQVVGAFLGSRPTTDGRDDTPLGRLADQLLPPTRIITDESVTPTRIIIEDRN
FT                   FAPGTEPFEPARPTPAEPAVGAEGAQPVDPAATGAPPVDTAVASGPPVDSTVAGGPTPP
FT                   EREVSSVGEAAPGEGPPPVEEAPDPVVVAARQVVTTLAQAMRCEPEMFDDSVDGLTDIL
FT                   REGGWTAPTLATHLVHMVVGGVKVGSDSPGDNLAWRLKHLPRASDQCPCAACRSWRNAV
FT                   AQTPAQTRSDRAGEDSPALPDVAEIERAAALGAEQAALLARARAS"
     METGQTVRTD ETMRQLSLPG VLVLVSTPSA DHLVADNVGW HRTVAQAGLP RATKLVALVL        60
     SSHVQPADGT DPDLPAGAAF CAPGLPVLVE QTGYSRTHVQ RQLAKLRELG WLSTVGRPAA       120
     GRPARFVLTL PAEVARLAGV GLAVPSQAPV AGQAPAPGPV PASHRPARPE PLAATARVAM       180
     QGWRPLDDVP ARAGFAMPER NAPTRAPDEV VASAVAGRPK SRRAAGHRVE GATETAVVEW       240
     EEDEEQVTEE DGPLTATGDR PRVIVGRHVF RRRGGRPLDN SKAAVRRRAQ VVGAFLGSRP       300
     TTDGRDDTPL GRLADQLLPP TRIITDESVT PTRIIIEDRN FAPGTEPFEP ARPTPAEPAV       360
     GAEGAQPVDP AATGAPPVDT AVASGPPVDS TVAGGPTPPE REVSSVGEAA PGEGPPPVEE       420
     APDPVVVAAR QVVTTLAQAM RCEPEMFDDS VDGLTDILRE GGWTAPTLAT HLVHMVVGGV       480
     KVGSDSPGDN LAWRLKHLPR ASDQCPCAAC RSWRNAVAQT PAQTRSDRAG EDSPALPDVA       540
     EIERAAALGA EQAALLARAR AS                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page