(data stored in ACNUC7421 zone)

EMBL: CP002299.PE77

CP002299.PE77        Location/Qualifiers
FT   CDS             complement(90984..92105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0077"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G3"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADP78165.1"
FT                   /translation="MTSTGPMLARRHGGSIMQASAAPGPLRGAGRARTSGDGPPTSAPS
FT                   ARSGQPAGPHRPGEVARPEESREATSPFSIANLTSVDSQFHSDGPFAPVGPVHPVELGG
FT                   PGGGLAPIGPGGFRPAGDLNERPSPAGVYDALLGGTAHRRVDRRSALAILLAWPDAPAA
FT                   ARAMKDFLVRAVRFAARNGVNQFLALGGGAGTVDPVHEVACAVAPESQTVYVEPDPLVI
FT                   ARSLPDIRDRQVALVQADVSRPAEVLRHPGVLAHLDVTQPIAIVMVPGLPEIADHEDPR
FT                   EVLRGYREVTARGSLLLFSQLCDEGSARGLRALFERAGQPGAPRPHEQTVELVSTWEPI
FT                   EPGLVPAEEWNAPDERGHPHFGRLPVYASVGWH"
     MTSTGPMLAR RHGGSIMQAS AAPGPLRGAG RARTSGDGPP TSAPSARSGQ PAGPHRPGEV        60
     ARPEESREAT SPFSIANLTS VDSQFHSDGP FAPVGPVHPV ELGGPGGGLA PIGPGGFRPA       120
     GDLNERPSPA GVYDALLGGT AHRRVDRRSA LAILLAWPDA PAAARAMKDF LVRAVRFAAR       180
     NGVNQFLALG GGAGTVDPVH EVACAVAPES QTVYVEPDPL VIARSLPDIR DRQVALVQAD       240
     VSRPAEVLRH PGVLAHLDVT QPIAIVMVPG LPEIADHEDP REVLRGYREV TARGSLLLFS       300
     QLCDEGSARG LRALFERAGQ PGAPRPHEQT VELVSTWEPI EPGLVPAEEW NAPDERGHPH       360
     FGRLPVYASV GWH                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page