(data stored in ACNUC7421 zone)

EMBL: CP002299.PE78

CP002299.PE78        Location/Qualifiers
FT   CDS             92781..94685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0078"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   fal:FRAAL6761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78166"
FT                   /db_xref="GOA:E3J3G4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G4"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ADP78166.1"
FT                   /translation="MAHSPTRRLGGSPFPPIAEYAFLSDCETTCLVAPSGNVEWMCVPR
FT                   PDAPSVFGSILDRSAGGFRFGPERIMIPAGRRYLPGTNVVETTWQTPNGWLIVTDCLVV
FT                   GRWHRTAARSKTHRRTPMDWDAEHVLLRTARCEHGTVDLSLVCEPNFDYGRKPESWEYE
FT                   GDGYASGIIRNADTDVTLRLRTDLRLGFDGRRALVRTTLKEGDTAFVALTWRAHEPMLP
FT                   TTYAQAMAAVDSTTEFWRQWLSRGMFPDHPWRRQLQRSALALKGLTYAPTGALLAAATT
FT                   SLPETPQGQRNWDYRFSWIRDSTFALWGLYTLGLDYEANDFFSFIADVCEEADDIQVMY
FT                   RVGGESDLQEQVLGHLSGYDGATPVRIGNDAYKQRQHDVWGTVLDSVYLHTKSRDYLSE
FT                   RLWPVLVQLAESAATHWRDADRGIWEVRGEPRHFTTSKMMCWVALDRGRRLAQMRGDLK
FT                   TAARWKTVAEEIHADVCARGVDERGVFTQYYGSTSLDASALLLPLLGFLPASDDRVKAT
FT                   VLAIADELTVDGLVLRYRTEETDDGIGGEEGAFLICSFWLVSALVEIGELHRARQLCER
FT                   LLSMASPLDLFAEEVDPPTGRHLGNFPQAFTHLALITAVMYVIRAEDAEAYARPSPST"
     MAHSPTRRLG GSPFPPIAEY AFLSDCETTC LVAPSGNVEW MCVPRPDAPS VFGSILDRSA        60
     GGFRFGPERI MIPAGRRYLP GTNVVETTWQ TPNGWLIVTD CLVVGRWHRT AARSKTHRRT       120
     PMDWDAEHVL LRTARCEHGT VDLSLVCEPN FDYGRKPESW EYEGDGYASG IIRNADTDVT       180
     LRLRTDLRLG FDGRRALVRT TLKEGDTAFV ALTWRAHEPM LPTTYAQAMA AVDSTTEFWR       240
     QWLSRGMFPD HPWRRQLQRS ALALKGLTYA PTGALLAAAT TSLPETPQGQ RNWDYRFSWI       300
     RDSTFALWGL YTLGLDYEAN DFFSFIADVC EEADDIQVMY RVGGESDLQE QVLGHLSGYD       360
     GATPVRIGND AYKQRQHDVW GTVLDSVYLH TKSRDYLSER LWPVLVQLAE SAATHWRDAD       420
     RGIWEVRGEP RHFTTSKMMC WVALDRGRRL AQMRGDLKTA ARWKTVAEEI HADVCARGVD       480
     ERGVFTQYYG STSLDASALL LPLLGFLPAS DDRVKATVLA IADELTVDGL VLRYRTEETD       540
     DGIGGEEGAF LICSFWLVSA LVEIGELHRA RQLCERLLSM ASPLDLFAEE VDPPTGRHLG       600
     NFPQAFTHLA LITAVMYVIR AEDAEAYARP SPST                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page