(data stored in ACNUC7421 zone)

EMBL: CP002299.PE79

CP002299.PE79        Location/Qualifiers
FT   CDS             94745..95116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78167"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6760"
FT                   /protein_id="ADP78167.1"
FT                   /translation="MAKLVVGGGRVEVVLSQAERLAALRGDVSAALDEIADVQVSPHPF
FT                   GELRGIRAPGTGVPGVIALGTWRHRGGKDFVAIYRRRPAVVVLLAAGCEFERLIVGVED
FT                   PDQTVAAIRAATGLVIGGA"
     MAKLVVGGGR VEVVLSQAER LAALRGDVSA ALDEIADVQV SPHPFGELRG IRAPGTGVPG        60
     VIALGTWRHR GGKDFVAIYR RRPAVVVLLA AGCEFERLIV GVEDPDQTVA AIRAATGLVI       120
     GGA                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page