(data stored in ACNUC7421 zone)

EMBL: CP002299.PE81

CP002299.PE81        Location/Qualifiers
FT   CDS             95736..96512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0081"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   fal:FRAAL6757 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78169"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G7"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADP78169.1"
FT                   /translation="MAAALAGLLLVLGWGSAGGARPPAGSALAGEHRALAGVVAADQAG
FT                   VDRSRDRLAQVRAALASPGPLAAPDPAGASRVPLAAGCTSADGSAGPPDCAGQAALLAQ
FT                   VGLTPVRGTAVVVSLDDTPRGRRAGPWPSGVRAPVADDLVVHQQDVQAVVNALWTGGAR
FT                   AMTLMGRRVTARTAVRCVGNTLLLEGNVYSPPFVVAAIGDPARLTAALDADPGVVLYRE
FT                   YVDAYDLGYHVETKANMTFPAATEPPTAVYATPLRD"
     MAAALAGLLL VLGWGSAGGA RPPAGSALAG EHRALAGVVA ADQAGVDRSR DRLAQVRAAL        60
     ASPGPLAAPD PAGASRVPLA AGCTSADGSA GPPDCAGQAA LLAQVGLTPV RGTAVVVSLD       120
     DTPRGRRAGP WPSGVRAPVA DDLVVHQQDV QAVVNALWTG GARAMTLMGR RVTARTAVRC       180
     VGNTLLLEGN VYSPPFVVAA IGDPARLTAA LDADPGVVLY REYVDAYDLG YHVETKANMT       240
     FPAATEPPTA VYATPLRD                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page