(data stored in ACNUC7421 zone)

EMBL: CP002299.PE82

CP002299.PE82        Location/Qualifiers
FT   CDS             complement(96546..97196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0082"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: fal:FRAAL6756 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78170"
FT                   /db_xref="GOA:E3J3G8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G8"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADP78170.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLDAECVVRRNDEVDPERVGELGV
FT                   DGVLLSPGPGTPEAAGMTIPMVTAASAAGLPVFGVCLGHQAIGVAFGATVDRAPELLHG
FT                   KTSVVHHNGAGVLADLPNPFVATRYHSLAVEAATLPPEIEITARTDSGVVMAMRHRTLP
FT                   IEGVQFHPESVLTQGGHLMLARWLDACGDGGASRALAPALSNEVETLRQAAFA"
     MRILVVDNYD SFVFNLVQYL GQLDAECVVR RNDEVDPERV GELGVDGVLL SPGPGTPEAA        60
     GMTIPMVTAA SAAGLPVFGV CLGHQAIGVA FGATVDRAPE LLHGKTSVVH HNGAGVLADL       120
     PNPFVATRYH SLAVEAATLP PEIEITARTD SGVVMAMRHR TLPIEGVQFH PESVLTQGGH       180
     LMLARWLDAC GDGGASRALA PALSNEVETL RQAAFA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page