(data stored in ACNUC7421 zone)

EMBL: CP002299.PE84

CP002299.PE84        Location/Qualifiers
FT   CDS             complement(99237..101051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0084"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: fal:FRAAL6754 serine/threonine-protein kinase PknA
FT                   (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78172"
FT                   /db_xref="GOA:E3J3H0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78172.1"
FT                   /translation="MNNPSGQPAHQPAQPFAGAVPANTVLDNRYRLDGRIATGGMGEVW
FT                   RGVDQTLGRPVAVKLLRPEYASDESFLVRFRGEARHAARLSHPGIASVYDYGEVATVDD
FT                   HPTAYLVMELVEGEPLSAVLHREKRLSPERMLDILGQAADALQAAHALNIVHRDIKPGN
FT                   LLIRHDGVVKVTDFGIARAVDAAPLTATGIMMGTAYYVSPEQASGRPVTPASDVYSLGV
FT                   VAYECLAGRRPFDDRNPIVVVMAHQQDNPPPLPGDVPHQVRQLVEQAMAKNPNRRPPSA
FT                   GGFARSAAAIQRELFSPEPRWAAGAGGVSPDMTARHPGPAGPPPRGRTRAASWLADGPA
FT                   GVPAAGGTSTPGSAAARGGYPGSAGASAAPGANYPGQNPGGRGGPATSYQQGATGYPPA
FT                   QPGGTGYQSPAGQTGYQAGGGFANRADGATGYQPGATGYQAGGTGYQQGANGYQPGATG
FT                   YQPGATGYQPEQAGYQPAPTAYQPTPTSYQPAGGGWADEQGDETSLAAAHLAPAGDLDE
FT                   PAGWQPGTRAARRAGSTRAGAAAGRRRRLSLPVLLVLLAITVVVCALITRSLAGSGGSN
FT                   HAASSVTQAVTTGTRGGGIVVVEANAGD"
     MNNPSGQPAH QPAQPFAGAV PANTVLDNRY RLDGRIATGG MGEVWRGVDQ TLGRPVAVKL        60
     LRPEYASDES FLVRFRGEAR HAARLSHPGI ASVYDYGEVA TVDDHPTAYL VMELVEGEPL       120
     SAVLHREKRL SPERMLDILG QAADALQAAH ALNIVHRDIK PGNLLIRHDG VVKVTDFGIA       180
     RAVDAAPLTA TGIMMGTAYY VSPEQASGRP VTPASDVYSL GVVAYECLAG RRPFDDRNPI       240
     VVVMAHQQDN PPPLPGDVPH QVRQLVEQAM AKNPNRRPPS AGGFARSAAA IQRELFSPEP       300
     RWAAGAGGVS PDMTARHPGP AGPPPRGRTR AASWLADGPA GVPAAGGTST PGSAAARGGY       360
     PGSAGASAAP GANYPGQNPG GRGGPATSYQ QGATGYPPAQ PGGTGYQSPA GQTGYQAGGG       420
     FANRADGATG YQPGATGYQA GGTGYQQGAN GYQPGATGYQ PGATGYQPEQ AGYQPAPTAY       480
     QPTPTSYQPA GGGWADEQGD ETSLAAAHLA PAGDLDEPAG WQPGTRAARR AGSTRAGAAA       540
     GRRRRLSLPV LLVLLAITVV VCALITRSLA GSGGSNHAAS SVTQAVTTGT RGGGIVVVEA       600
     NAGD                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page