(data stored in ACNUC7421 zone)

EMBL: CP002299.PE86

CP002299.PE86        Location/Qualifiers
FT   CDS             complement(102508..103995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0086"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78174"
FT                   /db_xref="GOA:E3J3H2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADP78174.1"
FT                   /translation="MTLPPLRRPRPADLTATFAGFPLPPGLEIPPYRRRELGLLVFAGV
FT                   LATGALAALMLAHNGTLTFQVATYGLGFFALWGLGHLAVRWFAPAADPMLLPLVAALNG
FT                   IGLVMIYRIDLARADAQRAAHKTVTAGAAQTQLVWTLLAIIVFVLVLAIVRDHTTLTRY
FT                   TYTAGLAGILFLILPAVPGIGASINGARLWLRVGPFSFQPSEVSKILLMIFFAGYLSRM
FT                   RDVISVASPTFLGLKLPRPRDLGPVLVAWAASLGVLVIENDLGSSLLLFAIFLVILYTA
FT                   TEQVSWVAIGLALFCCGALLADHLFSHVQVRVDGWLHAFDGSNPSGKSYQLVQGLYGFA
FT                   AGGITGTGLGQGNPRKVPFSNTDFIMASLGEELGLTGVMAILVMYALIVMRGLRAAIGA
FT                   RDPFGKLLATGLSASLAFQVFVQVGGVMRLIPLTGITLPFVSYGGSSIVANAAIIALLL
FT                   RISDSTIRSPREEAAPAPLYDPDAVAGARTQVVVKSP"
     MTLPPLRRPR PADLTATFAG FPLPPGLEIP PYRRRELGLL VFAGVLATGA LAALMLAHNG        60
     TLTFQVATYG LGFFALWGLG HLAVRWFAPA ADPMLLPLVA ALNGIGLVMI YRIDLARADA       120
     QRAAHKTVTA GAAQTQLVWT LLAIIVFVLV LAIVRDHTTL TRYTYTAGLA GILFLILPAV       180
     PGIGASINGA RLWLRVGPFS FQPSEVSKIL LMIFFAGYLS RMRDVISVAS PTFLGLKLPR       240
     PRDLGPVLVA WAASLGVLVI ENDLGSSLLL FAIFLVILYT ATEQVSWVAI GLALFCCGAL       300
     LADHLFSHVQ VRVDGWLHAF DGSNPSGKSY QLVQGLYGFA AGGITGTGLG QGNPRKVPFS       360
     NTDFIMASLG EELGLTGVMA ILVMYALIVM RGLRAAIGAR DPFGKLLATG LSASLAFQVF       420
     VQVGGVMRLI PLTGITLPFV SYGGSSIVAN AAIIALLLRI SDSTIRSPRE EAAPAPLYDP       480
     DAVAGARTQV VVKSP                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page