(data stored in ACNUC7421 zone)

EMBL: CP002299.PE87

CP002299.PE87        Location/Qualifiers
FT   CDS             complement(103992..105350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0087"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6751 serine/threonine specific
FT                   protein phosphatase; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78175"
FT                   /db_xref="GOA:E3J3H3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H3"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADP78175.1"
FT                   /translation="MSLRLHYAIRSDVGHVREGNEDSAYAGPYLLAVADGMGGHAAGEV
FT                   ASSTVIAALADLDTEIDADELVEALVSAMHDANANLRAMSARDGSLDGMGTTVTAVLAS
FT                   GDQFGVLHVGDSRCYLLRDEVLSQITHDHTLVQDLVDQGRITPEQANSHPQRSLLMRAL
FT                   DGREVDPDLSLRQARVGDRYLLCSDGLSGVVSGETILEALLGTSPQDAVDRLIELALKG
FT                   GGPDNITVVVADVVDDEESAQSAMVAGAAAEKESVPGATPARVGPNPRNPDSDSAAARA
FT                   ARIGRASRGGLSPEDFADGATPGRGRRRFVFVGATVAVLIVVTAIASWAWVRSQYYVGV
FT                   HDNKVAIFQGVQSLDALSSVHATFMPISEVAEPDQSAVRSGLHADDLADAQKKVSNLRT
FT                   VPASGSTSKPTTTPTATPTNKSTLPGTAASIAACATSDPAAALNCVSLTSPSP"
     MSLRLHYAIR SDVGHVREGN EDSAYAGPYL LAVADGMGGH AAGEVASSTV IAALADLDTE        60
     IDADELVEAL VSAMHDANAN LRAMSARDGS LDGMGTTVTA VLASGDQFGV LHVGDSRCYL       120
     LRDEVLSQIT HDHTLVQDLV DQGRITPEQA NSHPQRSLLM RALDGREVDP DLSLRQARVG       180
     DRYLLCSDGL SGVVSGETIL EALLGTSPQD AVDRLIELAL KGGGPDNITV VVADVVDDEE       240
     SAQSAMVAGA AAEKESVPGA TPARVGPNPR NPDSDSAAAR AARIGRASRG GLSPEDFADG       300
     ATPGRGRRRF VFVGATVAVL IVVTAIASWA WVRSQYYVGV HDNKVAIFQG VQSLDALSSV       360
     HATFMPISEV AEPDQSAVRS GLHADDLADA QKKVSNLRTV PASGSTSKPT TTPTATPTNK       420
     STLPGTAASI AACATSDPAA ALNCVSLTSP SP                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page