(data stored in ACNUC7421 zone)

EMBL: CP002299.PE88

CP002299.PE88        Location/Qualifiers
FT   CDS             complement(105347..105907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0088"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: fal:FRAAL6750 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78176"
FT                   /db_xref="GOA:E3J3H4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADP78176.1"
FT                   /translation="MDPSQPNELVLLLVKIGYLALLWTFVLLVVRAIRADLLEPARRRV
FT                   QRRGTPVRAGGGGGDAVARPRGHQQPAQPPAGLPAPAPPNAPNAYPPSKVVVTKGPLAG
FT                   TVIPLTGEPITIGRAPDSTLVLDDDFASGRHARLVPHDGRWFVEDLNSTNGTFLEHTKV
FT                   TTPMPVSLGAPVRIGKTVLELRR"
     MDPSQPNELV LLLVKIGYLA LLWTFVLLVV RAIRADLLEP ARRRVQRRGT PVRAGGGGGD        60
     AVARPRGHQQ PAQPPAGLPA PAPPNAPNAY PPSKVVVTKG PLAGTVIPLT GEPITIGRAP       120
     DSTLVLDDDF ASGRHARLVP HDGRWFVEDL NSTNGTFLEH TKVTTPMPVS LGAPVRIGKT       180
     VLELRR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page