(data stored in ACNUC7421 zone)

EMBL: CP002299.PE89

CP002299.PE89        Location/Qualifiers
FT   CDS             complement(105914..107746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0089"
FT                   /product="Protein of unknown function DUF2662"
FT                   /note="KEGG: fal:FRAAL6749 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2662; Forkhead-associated
FT                   protein; SMART: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78177"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H5"
FT                   /inference="protein motif:PFAM:PF12401"
FT                   /protein_id="ADP78177.1"
FT                   /translation="MGVLQRFERRLGGLVEGAFAKVFKGGVEPVEIAGALAREADDRRA
FT                   ISSNRVLVPNEFAVELASPDYNRLSPYSRALCDELAEMVREHAAEQRYTFVGPVSIRLS
FT                   EAPDLDVGVFRIRSSVASAEGMVATPQRRGSRAAPGVPRLLITNKEAPPGREREYELTA
FT                   ESTLIGRSVECDIRLTDTGVSRRHGEIRRMPDGNWLYVDAGSTNGSIVNGRPATQVKLV
FT                   NGDLIELGAALVTFQRDDGRGGRDSREPGRLGVEPPEPFGRPNDREPGGGPDAFRGGRG
FT                   VDRDGRLDPRDRLEPRDRLEPRDRPGPRGDQYRDRPDGPVRPDRPAGNRPDEPFNDRSG
FT                   ARGEPYRDRPPGPARADRPDRLGARPDEPFNDRSGARGEPYRDRQAGPARADRPRADEP
FT                   FDDRSGPRGEVFRDRSGARGEPYRDGPNGRPARPGPPRPEPQRDERPRHDPQRKDSPRP
FT                   GPPREPAQPEGPRPLGARRPAPADDRSGPRGARPRDEAYGGPSSARNEPNRDGPARLPR
FT                   DGRDARDARPRQDGDSDEYAGQGRGYGRRGDGSGPHPAGARRAGGRDAGGRDGRPPEEI
FT                   YDAETVLPSRAPGRPRSDDPRRRPGPPPPSDRSW"
     MGVLQRFERR LGGLVEGAFA KVFKGGVEPV EIAGALAREA DDRRAISSNR VLVPNEFAVE        60
     LASPDYNRLS PYSRALCDEL AEMVREHAAE QRYTFVGPVS IRLSEAPDLD VGVFRIRSSV       120
     ASAEGMVATP QRRGSRAAPG VPRLLITNKE APPGREREYE LTAESTLIGR SVECDIRLTD       180
     TGVSRRHGEI RRMPDGNWLY VDAGSTNGSI VNGRPATQVK LVNGDLIELG AALVTFQRDD       240
     GRGGRDSREP GRLGVEPPEP FGRPNDREPG GGPDAFRGGR GVDRDGRLDP RDRLEPRDRL       300
     EPRDRPGPRG DQYRDRPDGP VRPDRPAGNR PDEPFNDRSG ARGEPYRDRP PGPARADRPD       360
     RLGARPDEPF NDRSGARGEP YRDRQAGPAR ADRPRADEPF DDRSGPRGEV FRDRSGARGE       420
     PYRDGPNGRP ARPGPPRPEP QRDERPRHDP QRKDSPRPGP PREPAQPEGP RPLGARRPAP       480
     ADDRSGPRGA RPRDEAYGGP SSARNEPNRD GPARLPRDGR DARDARPRQD GDSDEYAGQG       540
     RGYGRRGDGS GPHPAGARRA GGRDAGGRDG RPPEEIYDAE TVLPSRAPGR PRSDDPRRRP       600
     GPPPPSDRSW                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page