(data stored in ACNUC7421 zone)

EMBL: CP002299.PE90

CP002299.PE90        Location/Qualifiers
FT   CDS             complement(108435..109181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0090"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="PFAM: Domain of unknown function DUF1994; KEGG:
FT                   fal:FRAAL6747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78178"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H6"
FT                   /inference="protein motif:PFAM:PF09352"
FT                   /protein_id="ADP78178.1"
FT                   /translation="MGTWVAGRLAAVVAAAATVAVLASGCNGVSTALSDTSTASPSGAL
FT                   PSGFAANGSDVGADGSALAALGTLKIAPLATSPKYDRDAFGTAWKDVDHNGCDTRNDVL
FT                   HRDLHSVTVRTTDNCIVLTGELNDPYTNRIIRFNRGKDSAAVQIDHVVPLGDAWRTGAY
FT                   AFPESEREAIANDPENLLAVDGPTNVKKSDSDASEWLPPAVGYRCTYVARQIGIKARYH
FT                   LWVTQAEADAMRTVLSSCASQPELGG"
     MGTWVAGRLA AVVAAAATVA VLASGCNGVS TALSDTSTAS PSGALPSGFA ANGSDVGADG        60
     SALAALGTLK IAPLATSPKY DRDAFGTAWK DVDHNGCDTR NDVLHRDLHS VTVRTTDNCI       120
     VLTGELNDPY TNRIIRFNRG KDSAAVQIDH VVPLGDAWRT GAYAFPESER EAIANDPENL       180
     LAVDGPTNVK KSDSDASEWL PPAVGYRCTY VARQIGIKAR YHLWVTQAEA DAMRTVLSSC       240
     ASQPELGG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page