(data stored in ACNUC7421 zone)

EMBL: CP002299.PE91

CP002299.PE91        Location/Qualifiers
FT   CDS             109446..110108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0091"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6746
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78179"
FT                   /db_xref="GOA:E3J3H7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78179.1"
FT                   /translation="MSSGGPQVVGVAASVPRPLRRDAERNRERILCAARELFVAHGLAV
FT                   GVDEIARRAGVGMGTLYRRFPNKDALVEETLAAAVGRVRELAVIARETSPPGRALREFL
FT                   MTSISDDACRWAFVSRRLWTGRTSALVFDDVVPLLGLMFTDAQEAGLIRADAVLADLIV
FT                   LLRAVRVVLELTDAPVGQTWRRYIDLLLDSLRPSEHNTSLDGPPMTLRALASSAIEP"
     MSSGGPQVVG VAASVPRPLR RDAERNRERI LCAARELFVA HGLAVGVDEI ARRAGVGMGT        60
     LYRRFPNKDA LVEETLAAAV GRVRELAVIA RETSPPGRAL REFLMTSISD DACRWAFVSR       120
     RLWTGRTSAL VFDDVVPLLG LMFTDAQEAG LIRADAVLAD LIVLLRAVRV VLELTDAPVG       180
     QTWRRYIDLL LDSLRPSEHN TSLDGPPMTL RALASSAIEP                             220
//

If you have problems or comments...

PBIL Back to PBIL home page