(data stored in ACNUC7421 zone)

EMBL: CP002299.PE92

CP002299.PE92        Location/Qualifiers
FT   CDS             110176..110535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0092"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: fal:FRAAL6737 metallo-beta-lactamase; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78180"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H8"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADP78180.1"
FT                   /translation="MAGMGPDQVPTVTVADIPAEPTGDDKLFLLDVREPDEWAAGHIDG
FT                   ATHIPMGDLVSRLDEVPRSARVIAVCRSGNRSGMVTGYLTKGGWDAYNLAGGMMAWAAG
FT                   GRPMTADSAGAPFVL"
     MAGMGPDQVP TVTVADIPAE PTGDDKLFLL DVREPDEWAA GHIDGATHIP MGDLVSRLDE        60
     VPRSARVIAV CRSGNRSGMV TGYLTKGGWD AYNLAGGMMA WAAGGRPMTA DSAGAPFVL        119
//

If you have problems or comments...

PBIL Back to PBIL home page