(data stored in ACNUC7421 zone)

EMBL: CP002299.PE96

CP002299.PE96        Location/Qualifiers
FT   CDS             113800..115215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0096"
FT                   /product="haloacid dehalogenase domain protein hydrolase"
FT                   /note="KEGG: kfl:Kfla_5922 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78184"
FT                   /db_xref="GOA:E3J3I2"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I2"
FT                   /inference="similar to AA sequence:KEGG:Kfla_5922"
FT                   /protein_id="ADP78184.1"
FT                   /translation="MSSAPLVVGFDLDLTLLDARRGIVATYAEIAARTGVPIDGELAAS
FT                   RLGPPLEQELANWFPADEVAGAATLYRELYVDHAVPVSEAMPGAARAVEAVRREGGRVV
FT                   VVTAKAEWLARASLAAIGIEPDVVVGWLWAAAKGDAIREHGVHIYVGDHEGDMRGARAG
FT                   GALSVGLTTGSHDADALSAAGADVVLGGLADFPDWLAGAVLDRRLAALSTRLTELGSVL
FT                   VAFSGGADSAFLLAWAARTLGPGAVVAATAVSPSLPAAELDAARAFVAALGVRHVLPST
FT                   DEQSRPGYLANGADRCYFCKAELTETLGPLAADLGLAHVVTGTNADDAVAGFRPGIRAA
FT                   AERGAATPLLDAGLTKRQVRAASRRLGLVTADKPAAACLASRIAYGIEVTPSRLARVEH
FT                   AEQALRLALADAELPCRDLRVRDLGDRARIEVDAELVPTLTARPDLTSAVTGFDLIEVD
FT                   PRGFRSGSMNELL"
     MSSAPLVVGF DLDLTLLDAR RGIVATYAEI AARTGVPIDG ELAASRLGPP LEQELANWFP        60
     ADEVAGAATL YRELYVDHAV PVSEAMPGAA RAVEAVRREG GRVVVVTAKA EWLARASLAA       120
     IGIEPDVVVG WLWAAAKGDA IREHGVHIYV GDHEGDMRGA RAGGALSVGL TTGSHDADAL       180
     SAAGADVVLG GLADFPDWLA GAVLDRRLAA LSTRLTELGS VLVAFSGGAD SAFLLAWAAR       240
     TLGPGAVVAA TAVSPSLPAA ELDAARAFVA ALGVRHVLPS TDEQSRPGYL ANGADRCYFC       300
     KAELTETLGP LAADLGLAHV VTGTNADDAV AGFRPGIRAA AERGAATPLL DAGLTKRQVR       360
     AASRRLGLVT ADKPAAACLA SRIAYGIEVT PSRLARVEHA EQALRLALAD AELPCRDLRV       420
     RDLGDRARIE VDAELVPTLT ARPDLTSAVT GFDLIEVDPR GFRSGSMNEL L                471
//

If you have problems or comments...

PBIL Back to PBIL home page