(data stored in ACNUC7421 zone)

EMBL: CP002299.PE97

CP002299.PE97        Location/Qualifiers
FT   CDS             115543..115938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0097"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: fal:FRAAL6743 CspB; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78185"
FT                   /db_xref="GOA:E3J3I3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADP78185.1"
FT                   /translation="MPTGKVKWYDVDKGFGFLSRDDGGDVFVHKAALPAGVEKLRAGDR
FT                   VEFGVAAGRKGDQALSLRILAEPPSVAKAVREAARRSPDELHAMVEDMIKVLDDVQRDL
FT                   RRGRYPDRRIAQRVAKVVHAVASELEA"
     MPTGKVKWYD VDKGFGFLSR DDGGDVFVHK AALPAGVEKL RAGDRVEFGV AAGRKGDQAL        60
     SLRILAEPPS VAKAVREAAR RSPDELHAMV EDMIKVLDDV QRDLRRGRYP DRRIAQRVAK       120
     VVHAVASELE A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page