(data stored in ACNUC7421 zone)

EMBL: CP002299.PE98

CP002299.PE98        Location/Qualifiers
FT   CDS             complement(115952..116851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0098"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   fal:FRAAL6735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78186"
FT                   /db_xref="GOA:E3J3I4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I4"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADP78186.1"
FT                   /translation="MSQVTAASEADQRERTGLTLAISPCPNDTFAFHALAHGLVPGVPP
FT                   VSVTFADIDVLNARAADGLDDLVKVSYAALPWLLDGYRLLPAGGALGRGCGPLVLMSAG
FT                   GPTAAGAQGDAAVLRGARVAIPGTRTTAYLLFRLWAAGIDVATIDVLPFEKIMPAVQAG
FT                   RYDAGLVIHESRFTYPSYGLVSVADLGDWWEGATGLPIPLGAILARRDLPAESGDLAAA
FT                   VRASVAAAFANPAASAAWVLEHSQELAPEVVQAHIDLYVNDFSLDLGDEGYAAAEELLA
FT                   RAAAENLVPPLPSPLRQP"
     MSQVTAASEA DQRERTGLTL AISPCPNDTF AFHALAHGLV PGVPPVSVTF ADIDVLNARA        60
     ADGLDDLVKV SYAALPWLLD GYRLLPAGGA LGRGCGPLVL MSAGGPTAAG AQGDAAVLRG       120
     ARVAIPGTRT TAYLLFRLWA AGIDVATIDV LPFEKIMPAV QAGRYDAGLV IHESRFTYPS       180
     YGLVSVADLG DWWEGATGLP IPLGAILARR DLPAESGDLA AAVRASVAAA FANPAASAAW       240
     VLEHSQELAP EVVQAHIDLY VNDFSLDLGD EGYAAAEELL ARAAAENLVP PLPSPLRQP        299
//

If you have problems or comments...

PBIL Back to PBIL home page