(data stored in ACNUC7421 zone)

EMBL: CP002299.PE99

CP002299.PE99        Location/Qualifiers
FT   CDS             complement(116903..117847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0099"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: fal:FRAAL6734 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78187"
FT                   /db_xref="GOA:E3J3I5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I5"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADP78187.1"
FT                   /translation="MSRTLIVTAVQAEADAVCAGLMGSWSRSRGPSSEVPSAPVSPDWD
FT                   RQLLTTSTLGPYVGRRRGPVTVLAAGTGGPAAAAGTAVALAVAAATGDPFTLVLSMGVA
FT                   GGFRGWAEVGDLAVASRLVAADLGAESGLEDLREPAGKVHEMDRSLGFHSTGAPPLPRA
FT                   TSSSADGKFLTLDDLDLGSSTIIPKSGLVERLATVVGITGRRVVTGPVLSVATVTGTEL
FT                   RAATLTARLDPVAEGMEGYAVGTAAAAFGVPAGEIRAISNQVGRRDRASWNLPAALASL
FT                   RTAAGALVAHPDGLLAAAADASAADGSRPPVGR"
     MSRTLIVTAV QAEADAVCAG LMGSWSRSRG PSSEVPSAPV SPDWDRQLLT TSTLGPYVGR        60
     RRGPVTVLAA GTGGPAAAAG TAVALAVAAA TGDPFTLVLS MGVAGGFRGW AEVGDLAVAS       120
     RLVAADLGAE SGLEDLREPA GKVHEMDRSL GFHSTGAPPL PRATSSSADG KFLTLDDLDL       180
     GSSTIIPKSG LVERLATVVG ITGRRVVTGP VLSVATVTGT ELRAATLTAR LDPVAEGMEG       240
     YAVGTAAAAF GVPAGEIRAI SNQVGRRDRA SWNLPAALAS LRTAAGALVA HPDGLLAAAA       300
     DASAADGSRP PVGR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page