(data stored in ACNUC7421 zone)

EMBL: CP002343.PE10

CP002343.PE10        Location/Qualifiers
FT   CDS             13179..15890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0010"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit; InterPro
FT                   IPR002205: IPR006691: IPR005743; KEGG: kse:Ksed_00070 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: Putative DNA
FT                   gyrase subunit A; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   domain, beta-propeller; TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46572"
FT                   /db_xref="GOA:E6SDW9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW9"
FT                   /protein_id="ADU46572.1"
FT                   /translation="MSDDLPPVDGDDILGPDETQPTEVDESHEQGTAPIERDPDQHDRV
FT                   EPIDLNTEMQRSYIEYAMSVIVSRALPDVRDGLKPVHRRIVYAMYDGGYRPDRGYNKCA
FT                   RVVGDVMGHYHPHGDSAIYDALVRLVQDWSMRYPLVDGQGNFGSRGNDGAAAPRYTECR
FT                   MASIALEMVRDIEQDTVDFIPNYDGKTMQPSVLPSRFPNLLVNGSAGIAVGMATQIPPH
FT                   NLREVAEGAQYYLHHPEISREELLEALLGIIKGPDFPTGSLIMGHRGIEDAYRTGRGSI
FT                   IMRAIVNVEEIKNRQCLVVTQLPYQVNPDQLAVKIADLVKDGKIAGIADIADETSGRTG
FT                   LRIVITLKRDAVAKVVLNNLYKHTQLQTTFGANMLALVDDVPRTLPLDGFIRHWVDHQI
FT                   EVIQRRTTFRLRKAEAEIHLLRGYLKALDMLDEVIALIRRSQTVEDARDGLIQLLDIDE
FT                   TQAQAILNMQLRRLAALERERIQQQHDELQELIDEYQAILASEVRQREIVSEELQGIVD
FT                   KYGDERRTEIVPFDGDMSMEDLIPEEDVVVTITRGGYAKRTRTDLYRSQRRGGKGVKGA
FT                   QLRGEDVVEHFFTTTTHHWLLFFTNLGRVYRAKGYELPEGSRDSKGQHVANLLAFQPGE
FT                   QIAQVLAIHDYEAADYLVLATRAGLVKKTRLRDYDSPRSGGLIAINLREGDELVGARLV
FT                   AAADDLLLVSRKGMSVRFTATDSALRPMGRSTSGVTGMKFRPGDTLLSMSRVPAETDVD
FT                   VFVVFENGLAKRTPVSEYRVQGRGGYGIQVAKLSEKGGDLVGALTVTGNDEVMVVMEKG
FT                   KIVRSRVDEVRHTSRSTQGVRFAAPDKGDAIVAVARNAESVTEEELEEVGDLEGTAPTS
FT                   PITTVPSTDGVPSDGSDEPTTESSDGDTGGDA"
     MSDDLPPVDG DDILGPDETQ PTEVDESHEQ GTAPIERDPD QHDRVEPIDL NTEMQRSYIE        60
     YAMSVIVSRA LPDVRDGLKP VHRRIVYAMY DGGYRPDRGY NKCARVVGDV MGHYHPHGDS       120
     AIYDALVRLV QDWSMRYPLV DGQGNFGSRG NDGAAAPRYT ECRMASIALE MVRDIEQDTV       180
     DFIPNYDGKT MQPSVLPSRF PNLLVNGSAG IAVGMATQIP PHNLREVAEG AQYYLHHPEI       240
     SREELLEALL GIIKGPDFPT GSLIMGHRGI EDAYRTGRGS IIMRAIVNVE EIKNRQCLVV       300
     TQLPYQVNPD QLAVKIADLV KDGKIAGIAD IADETSGRTG LRIVITLKRD AVAKVVLNNL       360
     YKHTQLQTTF GANMLALVDD VPRTLPLDGF IRHWVDHQIE VIQRRTTFRL RKAEAEIHLL       420
     RGYLKALDML DEVIALIRRS QTVEDARDGL IQLLDIDETQ AQAILNMQLR RLAALERERI       480
     QQQHDELQEL IDEYQAILAS EVRQREIVSE ELQGIVDKYG DERRTEIVPF DGDMSMEDLI       540
     PEEDVVVTIT RGGYAKRTRT DLYRSQRRGG KGVKGAQLRG EDVVEHFFTT TTHHWLLFFT       600
     NLGRVYRAKG YELPEGSRDS KGQHVANLLA FQPGEQIAQV LAIHDYEAAD YLVLATRAGL       660
     VKKTRLRDYD SPRSGGLIAI NLREGDELVG ARLVAAADDL LLVSRKGMSV RFTATDSALR       720
     PMGRSTSGVT GMKFRPGDTL LSMSRVPAET DVDVFVVFEN GLAKRTPVSE YRVQGRGGYG       780
     IQVAKLSEKG GDLVGALTVT GNDEVMVVME KGKIVRSRVD EVRHTSRSTQ GVRFAAPDKG       840
     DAIVAVARNA ESVTEEELEE VGDLEGTAPT SPITTVPSTD GVPSDGSDEP TTESSDGDTG       900
     GDA                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page