(data stored in ACNUC7421 zone)

EMBL: CP002343.PE100

CP002343.PE100       Location/Qualifiers
FT   CDS             108500..110347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0100"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   sro:Sros_5772 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   Extracellular solute-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46662"
FT                   /db_xref="GOA:E6SFC4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC4"
FT                   /protein_id="ADU46662.1"
FT                   /translation="MRRPTVPRLGVGATLLTALATTLVLGACTGPAATPGPASPSATTA
FT                   TATGRGTPASTTTSAERAPLVVETVFDFTSLDPRVLVERSGLLVADAAYETLTTLDPED
FT                   PTTVLPGLAEWTMSPERNWLTLRLRPDATFSDGTRVTSDDVVFTLARARGLGGTAAQLL
FT                   GPVGFTKVDDRTLTVITPGPNFALPAVLANPAFGILNADVVKQHGGAVGDGDTAGTWLS
FT                   WNSAGSGPYVVAEADAGRSITLQPNPHWSGPSPVFTEIVVRNAPPAQQVRDIESGAADV
FT                   VLDLPPDHADAMKLRPTVSSVAITSQTSPALAFLLLNDDQTVNRWTGNPDFVAAVRLGL
FT                   DLEAVTRRAGPGAVPALGLVPRGLPGAFEPPVPAATTPPTPTGRATGTAAPSPTSAPAS
FT                   VATSAPTSVPTSVPTSAATPTPSGTAAPIPTATPTTPRAGDLAAARAALARSGYRGEPI
FT                   RLSYASDRPLNGLDLRVVAAAIRDQLRPVGIRVVLAPAPMVKALSDYEKGLDVMGLWAW
FT                   TPEYAEPEAALAFAPGGHLAHRARWVRGVSSAMDALTAATRTSYGDERPGAFARWQLQM
FT                   EQFGPFVPLFQPAAHLAHGERVTAVPRTSIGSVDLAGIR"
     MRRPTVPRLG VGATLLTALA TTLVLGACTG PAATPGPASP SATTATATGR GTPASTTTSA        60
     ERAPLVVETV FDFTSLDPRV LVERSGLLVA DAAYETLTTL DPEDPTTVLP GLAEWTMSPE       120
     RNWLTLRLRP DATFSDGTRV TSDDVVFTLA RARGLGGTAA QLLGPVGFTK VDDRTLTVIT       180
     PGPNFALPAV LANPAFGILN ADVVKQHGGA VGDGDTAGTW LSWNSAGSGP YVVAEADAGR       240
     SITLQPNPHW SGPSPVFTEI VVRNAPPAQQ VRDIESGAAD VVLDLPPDHA DAMKLRPTVS       300
     SVAITSQTSP ALAFLLLNDD QTVNRWTGNP DFVAAVRLGL DLEAVTRRAG PGAVPALGLV       360
     PRGLPGAFEP PVPAATTPPT PTGRATGTAA PSPTSAPASV ATSAPTSVPT SVPTSAATPT       420
     PSGTAAPIPT ATPTTPRAGD LAAARAALAR SGYRGEPIRL SYASDRPLNG LDLRVVAAAI       480
     RDQLRPVGIR VVLAPAPMVK ALSDYEKGLD VMGLWAWTPE YAEPEAALAF APGGHLAHRA       540
     RWVRGVSSAM DALTAATRTS YGDERPGAFA RWQLQMEQFG PFVPLFQPAA HLAHGERVTA       600
     VPRTSIGSVD LAGIR                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page