(data stored in ACNUC7421 zone)

EMBL: CP002343.PE103

CP002343.PE103       Location/Qualifiers
FT   CDS             112129..113283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0103"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="COGs: COG3552 Protein containing von Willebrand
FT                   factor type A (vWA) domain; InterPro IPR008912: IPR011195:
FT                   IPR002035: IPR005829; KEGG: nca:Noca_3974 VWA containing
FT                   CoxE family protein; PFAM: VWA containing CoxE family
FT                   protein; SMART: von Willebrand factor type A; SPTR: VWA
FT                   containing CoxE family protein; PFAM: VWA domain containing
FT                   CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46665"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC7"
FT                   /protein_id="ADU46665.1"
FT                   /translation="MTAAPGDSSGSEIAPRWAADEWLLGFARALRAAGLPVTADRERTF
FT                   LVALREVGLGERRHVYWTGRATLTSSPADVERYDQVFTSWFSAEQPTQTRRPEREAPRA
FT                   TRASLEEVEGSSGPADGAEDAVQARASGLEVLRHRDVAALGIEERQGLARLFGRLRPRP
FT                   PRRRARRHVRSRTGEVDGPGTLREQLRRMGEPGRIHHRVRGSRPRRVVLLIDVSGSMSA
FT                   YADSLLRLAHTYVQAAGPRGPVEVFTMGTRLTHVTRALRVRDADRALIAAGEAVPDWSG
FT                   GTRLGESIAAFLDRWGRRGMARGAVVVVFSDGWERQGPELLGEQMRRLAALAHRVVWSN
FT                   PHRGKDGYLPVQQGIIAALPHVDDFVAGHSLAAFEELIEVVARA"
     MTAAPGDSSG SEIAPRWAAD EWLLGFARAL RAAGLPVTAD RERTFLVALR EVGLGERRHV        60
     YWTGRATLTS SPADVERYDQ VFTSWFSAEQ PTQTRRPERE APRATRASLE EVEGSSGPAD       120
     GAEDAVQARA SGLEVLRHRD VAALGIEERQ GLARLFGRLR PRPPRRRARR HVRSRTGEVD       180
     GPGTLREQLR RMGEPGRIHH RVRGSRPRRV VLLIDVSGSM SAYADSLLRL AHTYVQAAGP       240
     RGPVEVFTMG TRLTHVTRAL RVRDADRALI AAGEAVPDWS GGTRLGESIA AFLDRWGRRG       300
     MARGAVVVVF SDGWERQGPE LLGEQMRRLA ALAHRVVWSN PHRGKDGYLP VQQGIIAALP       360
     HVDDFVAGHS LAAFEELIEV VARA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page