(data stored in ACNUC7421 zone)

EMBL: CP002343.PE104

CP002343.PE104       Location/Qualifiers
FT   CDS             113276..114532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0104"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777;
FT                   KEGG: nca:Noca_3973 hypothetical protein; PFAM: protein of
FT                   unknown function DUF182; SPTR: Putative uncharacterized
FT                   protein; PFAM: XdhC and CoxI family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46666"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC8"
FT                   /protein_id="ADU46666.1"
FT                   /translation="MREVLRELTRWWEAGDVVGVGTVVGTWRSAPRQPGASMLVGPGGE
FT                   AVGSVSGGCVEGAVYELGQEVVASGVPVLHRYGISDDDAFAVGLTCGGILDVFVEKVSK
FT                   ETFPELGAVAADIEAGRPVAVATVIEHPDPSWLGRRIVVHPEAVDEEATRVAGVVDDGA
FT                   ARGSVDAGASPAAYGLRMSLGSERADAAVRDDARGLLAQGRTATLGYGPDGERRGEGMR
FT                   VFVQSHAPKPRMLVFGAIDFAAAVARVGSFLGYHVTVCDARPVFATRSRFPDADEVIVR
FT                   WPHDYLTEEVEGGRVDPRTVVAVLTHDPKFDVPVLEVALRLPEVAYIGAMGSRRTHEDR
FT                   LRRLREAGLTDEELARMSSPIGLDLGARTPEETAISIAAEIIALRWGGQGERLSELGGP
FT                   IHHHEHLDVHADHPDVPSP"
     MREVLRELTR WWEAGDVVGV GTVVGTWRSA PRQPGASMLV GPGGEAVGSV SGGCVEGAVY        60
     ELGQEVVASG VPVLHRYGIS DDDAFAVGLT CGGILDVFVE KVSKETFPEL GAVAADIEAG       120
     RPVAVATVIE HPDPSWLGRR IVVHPEAVDE EATRVAGVVD DGAARGSVDA GASPAAYGLR       180
     MSLGSERADA AVRDDARGLL AQGRTATLGY GPDGERRGEG MRVFVQSHAP KPRMLVFGAI       240
     DFAAAVARVG SFLGYHVTVC DARPVFATRS RFPDADEVIV RWPHDYLTEE VEGGRVDPRT       300
     VVAVLTHDPK FDVPVLEVAL RLPEVAYIGA MGSRRTHEDR LRRLREAGLT DEELARMSSP       360
     IGLDLGARTP EETAISIAAE IIALRWGGQG ERLSELGGPI HHHEHLDVHA DHPDVPSP         418
//

If you have problems or comments...

PBIL Back to PBIL home page