(data stored in ACNUC7421 zone)

EMBL: CP002343.PE108

CP002343.PE108       Location/Qualifiers
FT   CDS             complement(118545..119807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0109"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: kfl:Kfla_6439 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Bacterial protein of unknown function
FT                   (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46670"
FT                   /db_xref="GOA:E6SFD2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD2"
FT                   /protein_id="ADU46670.1"
FT                   /translation="MKELLRIRDARIALGARALSQLGDAMTLIALSILIAQTGQPLDLT
FT                   VLLVAFAAPVVALSSWAGRLVDTRDSRHLLTAAALVQVAGSAGLLASTSLGWQVGCILV
FT                   IQSGQAVAGPGWGALLPRIVGEEKVGRAIGLQQALGSAAWLAGTALGGLAFAAVGFHGV
FT                   ILIDTLAFGSLVGAALAVRTHRAGAGAGCPAPTPAPTPAPALESGWRILHRDRVSGLVV
FT                   AGLVLFVVALEGTNVVEAFLVIDVLGAGPAAYGLLGLCLGTGVTVGSVLCTRIDGDRRR
FT                   IAVLSAAAGTLGLTIAAAGLVGSVAWLYPLFVVAGLANGFINGLGFALVVGRTADAARG
FT                   RVLAAAMGTIRGGSVVSLLVAGVAAGWYGPRAVFVGAGLLTVTVAPVLLLARGRRAWAG
FT                   HGEPADASPGVTEVGAVEPAA"
     MKELLRIRDA RIALGARALS QLGDAMTLIA LSILIAQTGQ PLDLTVLLVA FAAPVVALSS        60
     WAGRLVDTRD SRHLLTAAAL VQVAGSAGLL ASTSLGWQVG CILVIQSGQA VAGPGWGALL       120
     PRIVGEEKVG RAIGLQQALG SAAWLAGTAL GGLAFAAVGF HGVILIDTLA FGSLVGAALA       180
     VRTHRAGAGA GCPAPTPAPT PAPALESGWR ILHRDRVSGL VVAGLVLFVV ALEGTNVVEA       240
     FLVIDVLGAG PAAYGLLGLC LGTGVTVGSV LCTRIDGDRR RIAVLSAAAG TLGLTIAAAG       300
     LVGSVAWLYP LFVVAGLANG FINGLGFALV VGRTADAARG RVLAAAMGTI RGGSVVSLLV       360
     AGVAAGWYGP RAVFVGAGLL TVTVAPVLLL ARGRRAWAGH GEPADASPGV TEVGAVEPAA       420
//

If you have problems or comments...

PBIL Back to PBIL home page