(data stored in ACNUC7421 zone)

EMBL: CP002343.PE109

CP002343.PE109       Location/Qualifiers
FT   CDS             119875..120465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0110"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: aau:AAur_3335 hypothetical
FT                   protein; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46671"
FT                   /db_xref="GOA:E6SFD3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD3"
FT                   /protein_id="ADU46671.1"
FT                   /translation="MATLRRPTEALEVDDPRALRALAHPARQRIINELLAGRVMTATEA
FT                   AELVGLSPSAVSHHLRALERYGIAERAETGGDARTRPWRSRFTELSYVPRSPGGVQVAN
FT                   AVVRGELAKLARNIAVVVEANEAAQQAGERPAPRDSVGISVSERWLTDEERRDVVARIE
FT                   ELLRTLPERHSGNAPEGSVRMSLVLSFVPVAGD"
     MATLRRPTEA LEVDDPRALR ALAHPARQRI INELLAGRVM TATEAAELVG LSPSAVSHHL        60
     RALERYGIAE RAETGGDART RPWRSRFTEL SYVPRSPGGV QVANAVVRGE LAKLARNIAV       120
     VVEANEAAQQ AGERPAPRDS VGISVSERWL TDEERRDVVA RIEELLRTLP ERHSGNAPEG       180
     SVRMSLVLSF VPVAGD                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page