(data stored in ACNUC7421 zone)

EMBL: CP002343.PE110

CP002343.PE110       Location/Qualifiers
FT   CDS             120591..121106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0111"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041: IPR002888; KEGG: gob:Gobs_4925 (2Fe-2S)-binding
FT                   domain protein; PFAM: [2Fe-2S]-binding domain-containing
FT                   protein; ferredoxin; SPTR: Hypothetical dehydrogenase;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; [2Fe-2S]
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46672"
FT                   /db_xref="GOA:E6SFD4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD4"
FT                   /protein_id="ADU46672.1"
FT                   /translation="MTRITVKVDGVEYSDDIEPRTLLVHYLRETVGKTGTVVGCDTSNC
FT                   GACTVHLDGRSVKSCNVLAVQVDGHEVTTIEGLADTAGTDGTLHPMQVAFHEAHGLQCG
FT                   YCTPGMIMQACDLLKENPDPTEAEIREGLEGNLCRCTGYHNIVKAVQQAAAAMAGSRPE
FT                   PTREEVTS"
     MTRITVKVDG VEYSDDIEPR TLLVHYLRET VGKTGTVVGC DTSNCGACTV HLDGRSVKSC        60
     NVLAVQVDGH EVTTIEGLAD TAGTDGTLHP MQVAFHEAHG LQCGYCTPGM IMQACDLLKE       120
     NPDPTEAEIR EGLEGNLCRC TGYHNIVKAV QQAAAAMAGS RPEPTREEVT S                171
//

If you have problems or comments...

PBIL Back to PBIL home page