(data stored in ACNUC7421 zone)

EMBL: CP002343.PE111

CP002343.PE111       Location/Qualifiers
FT   CDS             121103..123592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0112"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674: IPR008274; KEGG: nca:Noca_3969 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; SPTR: Nicotine dehydrogenase chain C; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead
FT                   domain; TIGRFAM: carbon-monoxide dehydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46673"
FT                   /db_xref="GOA:E6SFD5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD5"
FT                   /protein_id="ADU46673.1"
FT                   /translation="MTMTEDTPTTEAPTGEVGRARKRKEDQRLITGRTRWTDNITLPGM
FT                   LHIAMVRSPFAHARVTAIATAEAKAARNVVAVLTGEDLKEVQGVNANAWPIATDQVTPT
FT                   HLPMAVDHVACAGEIVACVVARSAAEARDAAELVDVDYDELPAVLDMKEALKDEVLAHP
FT                   DLGTNKSAFWQLDSKEAGSGDDVDEAIEAARSDGIVIEREFRQQRLIPAFMEPRSVVVD
FT                   PTGEQITMWSATQIPHILRFLLAATTGVSESKIRVIAPDVGGGFGGKLQTTPEEFVAFA
FT                   AARRLGKPVKYTETRSESLVSGHHGRDQWQKLTLSARRDGTVTGLKVELLADLGAYVAL
FT                   VGGGVPVLGAWMFNSIYKFPAYRFNVQTILTNKTWVDAYRGAGRPEATFGIERMMDELA
FT                   AELGRDPLEVREQNWITHEEFPFTTVAGMTYDSGNYEAATARARELFDYDALRAEQQRR
FT                   REANDPVQLGIGVSTFTEMCGLAPSRVLGSLSYGAGGWEHASIRMLPTGKVEVVTGTSP
FT                   HGQGHETAWSQIVADRLGVPFEDVEVLHGDTQISHKGLDTYGSRSLVVGGEALVLAADK
FT                   VIEKARPIAAHLLEASADDLEFSAGRFGVKGTDQGLTMAEIALASFAAHNLPDGVEPGL
FT                   DSDATYDPVNFSFPHGTHLCAMEVDTETGASRMRSYVCVDDIGVVVNPLIADGQIHGGL
FT                   VQGIAQALWEGAEYDENGTLVTGSFVDYTLPTAADTISFVTDYTVSPSTTNTLGTKGVG
FT                   EAGTIASTPAVVNAIVDALRPMGVHDVPMPCTPERVWRAIQSGGSDRQVESSGDAQPHF
FT                   DPAAPNQDTPETEGGAR"
     MTMTEDTPTT EAPTGEVGRA RKRKEDQRLI TGRTRWTDNI TLPGMLHIAM VRSPFAHARV        60
     TAIATAEAKA ARNVVAVLTG EDLKEVQGVN ANAWPIATDQ VTPTHLPMAV DHVACAGEIV       120
     ACVVARSAAE ARDAAELVDV DYDELPAVLD MKEALKDEVL AHPDLGTNKS AFWQLDSKEA       180
     GSGDDVDEAI EAARSDGIVI EREFRQQRLI PAFMEPRSVV VDPTGEQITM WSATQIPHIL       240
     RFLLAATTGV SESKIRVIAP DVGGGFGGKL QTTPEEFVAF AAARRLGKPV KYTETRSESL       300
     VSGHHGRDQW QKLTLSARRD GTVTGLKVEL LADLGAYVAL VGGGVPVLGA WMFNSIYKFP       360
     AYRFNVQTIL TNKTWVDAYR GAGRPEATFG IERMMDELAA ELGRDPLEVR EQNWITHEEF       420
     PFTTVAGMTY DSGNYEAATA RARELFDYDA LRAEQQRRRE ANDPVQLGIG VSTFTEMCGL       480
     APSRVLGSLS YGAGGWEHAS IRMLPTGKVE VVTGTSPHGQ GHETAWSQIV ADRLGVPFED       540
     VEVLHGDTQI SHKGLDTYGS RSLVVGGEAL VLAADKVIEK ARPIAAHLLE ASADDLEFSA       600
     GRFGVKGTDQ GLTMAEIALA SFAAHNLPDG VEPGLDSDAT YDPVNFSFPH GTHLCAMEVD       660
     TETGASRMRS YVCVDDIGVV VNPLIADGQI HGGLVQGIAQ ALWEGAEYDE NGTLVTGSFV       720
     DYTLPTAADT ISFVTDYTVS PSTTNTLGTK GVGEAGTIAS TPAVVNAIVD ALRPMGVHDV       780
     PMPCTPERVW RAIQSGGSDR QVESSGDAQP HFDPAAPNQD TPETEGGAR                   829
//

If you have problems or comments...

PBIL Back to PBIL home page