(data stored in ACNUC7421 zone)

EMBL: CP002343.PE112

CP002343.PE112       Location/Qualifiers
FT   CDS             123589..124446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0113"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR002346: IPR005107: IPR016166; KEGG: nca:Noca_3968 carbon
FT                   monoxide dehydrogenase, medium subunit; PFAM: molybdopterin
FT                   dehydrogenase FAD-binding; CO dehydrogenase flavoprotein
FT                   domain protein; SPTR: Molybdopterin dehydrogenase; PFAM:
FT                   FAD binding domain in molybdopterin dehydrogenase; CO
FT                   dehydrogenase flavoprotein C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46674"
FT                   /db_xref="GOA:E6SFD6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD6"
FT                   /protein_id="ADU46674.1"
FT                   /translation="MIPASFDYVAPTTVAEALAALAEHGDEAKVLAGGQSLLPILRMRL
FT                   NAPSVVIDLGRIAELQGISEEGDVIVIGAMTPYAAVLASEVVSTHAGLLSKAVATVADP
FT                   QIRHRGTVGGALVHADPAGDVGAPVLALGAQVVVAGAGGQTRTVAADDFFEDLFTTAVG
FT                   EGELLTQIRIPKHTGWGSHYEKFVRVSHQWSIVAVAAAVRVEGGSIAEARVGLTNMGAT
FT                   PLRARSVEAALVGQAPTDEAVRAAVAQVADGTNPPSDLNGGADYRRHLATVLTRRAVLA
FT                   AAGA"
     MIPASFDYVA PTTVAEALAA LAEHGDEAKV LAGGQSLLPI LRMRLNAPSV VIDLGRIAEL        60
     QGISEEGDVI VIGAMTPYAA VLASEVVSTH AGLLSKAVAT VADPQIRHRG TVGGALVHAD       120
     PAGDVGAPVL ALGAQVVVAG AGGQTRTVAA DDFFEDLFTT AVGEGELLTQ IRIPKHTGWG       180
     SHYEKFVRVS HQWSIVAVAA AVRVEGGSIA EARVGLTNMG ATPLRARSVE AALVGQAPTD       240
     EAVRAAVAQV ADGTNPPSDL NGGADYRRHL ATVLTRRAVL AAAGA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page