(data stored in ACNUC7421 zone)

EMBL: CP002343.PE114

CP002343.PE114       Location/Qualifiers
FT   CDS             complement(125338..126273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0115"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR003462; KEGG: krh:KRH_11610 ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   ornithine cyclodeaminase/mu-crystallin; SPTR: Ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   Ornithine cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46676"
FT                   /db_xref="GOA:E6SFD8"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD8"
FT                   /protein_id="ADU46676.1"
FT                   /translation="MEAPRWIDAAHIRRALSPEQARRLIREALEGDFDPAGDPARLAPV
FT                   VPGGQLLIMPSSTGDSVGVKVLSVAPGNPVRGLERIQALYVLFDADTLAPSVILDGSAI
FT                   TSLRTPAVSAVAVDALAPPTTRTLTVFGGGPQALGHVEAVLAVRQPERVVIVTRHLDGA
FT                   RATARRIDELGVETTALAAEDVRVRTAVGGSEVVVTATSAGTPVLDGSWVADGACVVAI
FT                   GSHEPDRRELDAALLGRSLVVVEDIGTALREAGDVVLAMGEGVLSTADLHPLKDLVTGA
FT                   VGRATDRPNVFKSVGMSWEDLVIAAGVARA"
     MEAPRWIDAA HIRRALSPEQ ARRLIREALE GDFDPAGDPA RLAPVVPGGQ LLIMPSSTGD        60
     SVGVKVLSVA PGNPVRGLER IQALYVLFDA DTLAPSVILD GSAITSLRTP AVSAVAVDAL       120
     APPTTRTLTV FGGGPQALGH VEAVLAVRQP ERVVIVTRHL DGARATARRI DELGVETTAL       180
     AAEDVRVRTA VGGSEVVVTA TSAGTPVLDG SWVADGACVV AIGSHEPDRR ELDAALLGRS       240
     LVVVEDIGTA LREAGDVVLA MGEGVLSTAD LHPLKDLVTG AVGRATDRPN VFKSVGMSWE       300
     DLVIAAGVAR A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page