(data stored in ACNUC7421 zone)

EMBL: CP002343.PE117

CP002343.PE117       Location/Qualifiers
FT   CDS             complement(127414..128121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_0885 proline-threonine-rich
FT                   repeat-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46679"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE1"
FT                   /protein_id="ADU46679.1"
FT                   /translation="MTTTIGMRRRAVWLITSVAFAATGALALSSATSATADEHNQWVYV
FT                   CKYVGTPGVDERLQTGQNPILVSVNAIDGPPVIGAPFQDAQGRSVVIGYGEPGGGQEGE
FT                   PEPVCPPELPPPPTETTTPPPTETTTPPTTETTTPPTTETTTPPTTETTTPPTTETTTG
FT                   TTPPEQPPGTTPPGAGGGVTPGPGAPDTGGGPAGGAGDSVPVNGLIGTGLLLGAAGILT
FT                   SEAVRRRRVVADG"
     MTTTIGMRRR AVWLITSVAF AATGALALSS ATSATADEHN QWVYVCKYVG TPGVDERLQT        60
     GQNPILVSVN AIDGPPVIGA PFQDAQGRSV VIGYGEPGGG QEGEPEPVCP PELPPPPTET       120
     TTPPPTETTT PPTTETTTPP TTETTTPPTT ETTTPPTTET TTGTTPPEQP PGTTPPGAGG       180
     GVTPGPGAPD TGGGPAGGAG DSVPVNGLIG TGLLLGAAGI LTSEAVRRRR VVADG            235
//

If you have problems or comments...

PBIL Back to PBIL home page