(data stored in ACNUC7421 zone)

EMBL: CP002343.PE119

CP002343.PE119       Location/Qualifiers
FT   CDS             complement(129640..130113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0120"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nml:Namu_3671 hemerythrin
FT                   HHE cation binding domain protein; PFAM: Hemerythrin HHE
FT                   cation binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding domain protein; PFAM: Hemerythrin HHE cation
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46681"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE3"
FT                   /protein_id="ADU46681.1"
FT                   /translation="MCSYCGCRDISLIGRFMTEHEEIVNVAGVLHRAVEGHGPDSVAEA
FT                   LGHTLAHLHPHTTAEERGLFAVLRRNPDFTEHIDGLCAEHARLDDLAERIRGGDTALVN
FT                   TFYDELRDHIDKEDNGLFPAAAIEMDGPDWVEAIQLTPDEGPHTHDEPHDDTH"
     MCSYCGCRDI SLIGRFMTEH EEIVNVAGVL HRAVEGHGPD SVAEALGHTL AHLHPHTTAE        60
     ERGLFAVLRR NPDFTEHIDG LCAEHARLDD LAERIRGGDT ALVNTFYDEL RDHIDKEDNG       120
     LFPAAAIEMD GPDWVEAIQL TPDEGPHTHD EPHDDTH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page