(data stored in ACNUC7421 zone)

EMBL: CP002343.PE12

CP002343.PE12        Location/Qualifiers
FT   CDS             16735..16920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_0010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46574"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX1"
FT                   /protein_id="ADU46574.1"
FT                   /translation="MLKRLALIAGAVASVAFIRKKARQQQAEQDLWNQATDDVKAQAPA
FT                   PAPSPAADQDLTAATS"
     MLKRLALIAG AVASVAFIRK KARQQQAEQD LWNQATDDVK AQAPAPAPSP AADQDLTAAT        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page