(data stored in SCRATCH zone)

EMBL: CP002343.PE122

CP002343.PE122       Location/Qualifiers
FT   CDS             131275..132492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0123"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR005110: IPR001453: IPR005111: IPR020817; KEGG:
FT                   bcv:Bcav_1229 molybdenum cofactor synthesis domain protein;
FT                   PFAM: molybdopterin binding domain; MoeA domain protein
FT                   domain I and II; MoeA domain protein domain IV; SPTR:
FT                   Molybdenum cofactor synthesis domain protein; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46684"
FT                   /db_xref="GOA:E6SFE6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE6"
FT                   /protein_id="ADU46684.1"
FT                   /translation="MGVGQNEPVPHTSVAEHRIALRHVIGAAATEVIPVDRHALGRRLA
FT                   EPLLAIDDLPRFDSSAMDGYAAVPETPDQRVFLVVGDVAAGDAAGFVLEPGQAARVMTG
FT                   ARLPTGAVGVVPVEQTDAERTGPAPRQVTFAAPVAPGRHVRKQAEDIAAGVPVAGTGAP
FT                   LTAAVIALARSAGCTEAVVHVPTRVAVVATGAELTVPGVDPGRGGIHESNSEMVAALAS
FT                   AAGCSVTRVATCTDDPGALEGLLTELSAAPDVDLVITTGGVSAGAYEVVRQVCEPRESF
FT                   SFVHLAMQPGGPQGLGRWDGMPVVCLPGTPVGAFVSFEMLVRPALDERHGAPARGASSA
FT                   AYVGRPRHTRAGMVQFISGVVAPDGTVSAPDARHLSALAGSNALIEVPETVEQIVPGDI
FT                   VTVHPL"
     MGVGQNEPVP HTSVAEHRIA LRHVIGAAAT EVIPVDRHAL GRRLAEPLLA IDDLPRFDSS        60
     AMDGYAAVPE TPDQRVFLVV GDVAAGDAAG FVLEPGQAAR VMTGARLPTG AVGVVPVEQT       120
     DAERTGPAPR QVTFAAPVAP GRHVRKQAED IAAGVPVAGT GAPLTAAVIA LARSAGCTEA       180
     VVHVPTRVAV VATGAELTVP GVDPGRGGIH ESNSEMVAAL ASAAGCSVTR VATCTDDPGA       240
     LEGLLTELSA APDVDLVITT GGVSAGAYEV VRQVCEPRES FSFVHLAMQP GGPQGLGRWD       300
     GMPVVCLPGT PVGAFVSFEM LVRPALDERH GAPARGASSA AYVGRPRHTR AGMVQFISGV       360
     VAPDGTVSAP DARHLSALAG SNALIEVPET VEQIVPGDIV TVHPL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page