(data stored in SCRATCH zone)

EMBL: CP002343.PE124

CP002343.PE124       Location/Qualifiers
FT   CDS             complement(132947..133801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0125"
FT                   /product="formate dehydrogenase subunit FdhD"
FT                   /note="COGs: COG1526 Uncharacterized protein required for
FT                   formate dehydrogenase activity; InterPro IPR003786; KEGG:
FT                   msm:MSMEG_0165 formate dehydrogenase accessory protein;
FT                   PFAM: formate dehydrogenase subunit FdhD; SPTR: Formate
FT                   dehydrogenase family accessory protein FdhD; PFAM:
FT                   FdhD/NarQ family; TIGRFAM: formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46686"
FT                   /db_xref="GOA:E6SFE8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE8"
FT                   /protein_id="ADU46686.1"
FT                   /translation="MGRVTQRTKVTVVDVSGDRPTSRSRTDTVTVEEPLELRVGGTPLT
FT                   VTMRTPGHDIELVHGFLLTEGIIRDAADVSLARYCEGAVVSGESGFEENTYNVIDVTLA
FT                   PGVAQPAAELARNFFTSSSCGVCGKASIEQLRARTQWPVRDDATRWPAAVITAMPERMR
FT                   SEQRSFDKTGGLHAAGLFGPGGELLAVREDVGRHNAVDKVLGWALLSGRLPATGCVLMV
FT                   SGRASFELTQKALMGGVPCLAAVSAPSSLAVETASDAGMTLLGFVRGATLNVYSRGDRL
FT                   RFP"
     MGRVTQRTKV TVVDVSGDRP TSRSRTDTVT VEEPLELRVG GTPLTVTMRT PGHDIELVHG        60
     FLLTEGIIRD AADVSLARYC EGAVVSGESG FEENTYNVID VTLAPGVAQP AAELARNFFT       120
     SSSCGVCGKA SIEQLRARTQ WPVRDDATRW PAAVITAMPE RMRSEQRSFD KTGGLHAAGL       180
     FGPGGELLAV REDVGRHNAV DKVLGWALLS GRLPATGCVL MVSGRASFEL TQKALMGGVP       240
     CLAAVSAPSS LAVETASDAG MTLLGFVRGA TLNVYSRGDR LRFP                        284
//

If you have problems or comments...

PBIL Back to PBIL home page