(data stored in SCRATCH zone)

EMBL: CP002343.PE127

CP002343.PE127       Location/Qualifiers
FT   CDS             complement(135221..137155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0128"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR007887:
FT                   IPR001460: IPR002137; KEGG: nca:Noca_4600
FT                   penicillin-binding protein, transpeptidase; PFAM:
FT                   penicillin-binding protein transpeptidase; NTF2 domain
FT                   protein transpeptidase; SPTR: Penicillin-binding protein,
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain; NTF2-like N-terminal transpeptidase
FT                   domain; Penicillin-binding Protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46689"
FT                   /db_xref="GOA:E6SFF1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF1"
FT                   /protein_id="ADU46689.1"
FT                   /translation="MRRGTSTRRTISAAVSLVLATSLTAGCSLFESDPDPADTATALAR
FT                   GLARGDLTGVTLSGTTAQQATAFLKGVYEDLGDLRPSVAVAGVVPDEEGTSATATLRTT
FT                   WDVSASAQDWTYETQVPLTLAENTWQVRWAPSVVAPELAADETLDIVRTWPRRADIVDR
FT                   RGGRLMTEREVAHIGIDKTKVSGATATRSARALAEVVGVDGTAFADRVAAAGPKAFVAA
FT                   ITLRVTDPTLADNVDRIDSVDGALRVPAMQVLAPTRTWAAPILGRVAEATAEQIEKSGG
FT                   VLEVGDVVGQNGLQLRYDERLRGKPGVAVHAVQRGKDGSAIDKRELFAEPSEKAEPLAV
FT                   TLDAKAQTAAEAALAEQTKRPTALVAVKVSTGEVLAAAVGPGAEQAPLALAGKEAPGST
FT                   FKIASALALIRKGATAETKLPCTDTLTVNGRVFGNYSRYPSSQLGDIPLERAVAYSCNT
FT                   AFISQHEKVSQDELIAAAESLGMGEELDLPFTGFLGSVPPTDDVVERAASFIGQGRVEA
FT                   SPLTMALVIASVMRGETVRPRLVVTDTALPAPATPLRQEEAEVLRRALRAVVTEGSGTV
FT                   LRTVGVEYAKTGTAEFGTTNPPRTHAWMVAGRGDLAIAAYHEEGPSGTTHAAPFIIDFL
FT                   RSYDAEDAG"
     MRRGTSTRRT ISAAVSLVLA TSLTAGCSLF ESDPDPADTA TALARGLARG DLTGVTLSGT        60
     TAQQATAFLK GVYEDLGDLR PSVAVAGVVP DEEGTSATAT LRTTWDVSAS AQDWTYETQV       120
     PLTLAENTWQ VRWAPSVVAP ELAADETLDI VRTWPRRADI VDRRGGRLMT EREVAHIGID       180
     KTKVSGATAT RSARALAEVV GVDGTAFADR VAAAGPKAFV AAITLRVTDP TLADNVDRID       240
     SVDGALRVPA MQVLAPTRTW AAPILGRVAE ATAEQIEKSG GVLEVGDVVG QNGLQLRYDE       300
     RLRGKPGVAV HAVQRGKDGS AIDKRELFAE PSEKAEPLAV TLDAKAQTAA EAALAEQTKR       360
     PTALVAVKVS TGEVLAAAVG PGAEQAPLAL AGKEAPGSTF KIASALALIR KGATAETKLP       420
     CTDTLTVNGR VFGNYSRYPS SQLGDIPLER AVAYSCNTAF ISQHEKVSQD ELIAAAESLG       480
     MGEELDLPFT GFLGSVPPTD DVVERAASFI GQGRVEASPL TMALVIASVM RGETVRPRLV       540
     VTDTALPAPA TPLRQEEAEV LRRALRAVVT EGSGTVLRTV GVEYAKTGTA EFGTTNPPRT       600
     HAWMVAGRGD LAIAAYHEEG PSGTTHAAPF IIDFLRSYDA EDAG                        644
//

If you have problems or comments...

PBIL Back to PBIL home page